SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015324283.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015324283.1.59421
Domain Number 1 Region: 154-650
Classification Level Classification E-value
Superfamily Sema domain 1.07e-99
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1514-1639,1805-1961
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-33
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 991-1082
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000523
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 1082-1172
Classification Level Classification E-value
Superfamily E set domains 0.000000000000187
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 1170-1250
Classification Level Classification E-value
Superfamily E set domains 0.0000000000747
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 653-704
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000471
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015324283.1.59421
Sequence length 2029
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1 isoform X2 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MRAGAGPGAGGAREAGRRRAGAAGAGPRRVRGGAAPARPELRGATEPAGAPGRGGWLAGA
GRKRASRPGPPPRLLPPPAPGSRPRRAHALAVPRRPAHAGCSSRRGGGTLSARAAAASPA
ARPPFRAPQCPPPPLLLWLLLLLGAARIGALEIQRRFPSPTPTNNFALDGAAGTVYLAAV
NRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGL
VVVCGSIYQGFCQLRRRGNISAVAVPFPPAAPPAAPVTVFPSMLNVAANHPNASTVGLLL
PPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFD
LNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPRPGAQTYAYLALNSEARAGDKESQARS
LLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPTRELLFAVFERPQ
GTPAARAAPAALCAFRFADVQAAIRAARTACFVDPAPDVVAVLDSVVQGTGPACERKRNI
QLQPEQLDCGAAHLQHPLSVLQPLKALPVFRAPGLSSVAVASVGNYTVVFLGTVSGRLLK
INLNESMQVVSRKVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQMARVKVAACAAHTTCG
DCVGAADAYCGWCALETRCTLQQDCANSSQPHFWTSASAGPGRCPAMTVLPAEIDVHQEY
PGMILQISGSLPSLSGMEMACDYGHGIHTVARVPGPAFGHQIAYCNLLPKDQFPPFPPHQ
DHVTVEMSVRVRGQNIVRASFTIYDCGRVGQVYPHTACTSCLSAQWPCVWCAQQHACVSN
QSRCEASPNPTSPQECPQILPSALAPMPTGGSQSIPVHLASAAFFQGAALECSFGLEETF
EAVWVNESAVRCKHVVLHTTQKSQVFPLSLQLKGRPARFLDSPDPMTVEVYNCAVGSPDC
SQCLGREDLGHLCVWSDGCRPRGTLQPTPGTCPAPEIRAIEPLSGPLDGGTQLTIRGRNL
GRRFSDVAHGVWIGGVACEPLADRYTVSEEIVCATGPAPEAFSDVVTVNASKEGRSRERF
SYVLPLVHSLEPAMGPKAGGTRITIHGSELHVGSELQVLVNNTEPCTELLRSDASIACTV
PGGTLPAMVPVCVRFEQRGCVRGGLSFQYMPNPVITAISPHRSHVSGGRTITVAGERFHM
VQKVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFLNGRVYADEAAVAEEL
LEPEEAQRGSQFRLDYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDGLGLESHEYRVK
IGQVACDIQIVSERVIHCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSI
VICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDL
TKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEW
KIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKL
EYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFL
LLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMD
TDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKL
NTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRK
KVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDP
DTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSISDLQLGKD
SPTNKLLYAKEIPEYRKIVQCYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAE
IYKYAKRYRPQIMSALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_015324283.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]