SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015325020.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015325020.1.59421
Domain Number 1 Region: 245-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000016
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015325020.1.59421
Sequence length 1482
Comment PREDICTED: zinc finger protein 518A [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MPSEQKHLFFDEKQNTLKKDYDVKNEVVDSLRSKISEPKFQNQLKPNISESSFHYGLKNV
KIVLPKIHIPNEVLLKHEVDKYRKLFQHKPQTARKSINVKTVSSVEECMLLHQSERVDEG
IKMSAKILNFSCLKCRDSTRYSPNDLQKHFQMWHHGELPSYPCEMCSFSANDFQVFKQHR
RTHRITLVKCDICNNENLYTLLDLTKHFSSTHCVNGTFQCEKCEFSTQDVGTFVQHIHRH
NEILYKCGKCHYICLTKGELQKHLYIHSGTFPFTCQYCSYGATRREHLVRHVITLHKEHL
YAKEKLEKDKYEKRMAKSSAGLKLILKRYKIGASRKTFWRRKKVNNASDRSIEKNTQVLK
KVNRTQATSEDPGHLVQEHVNEEKHERLYCENNDKPAESELGKPTLVSTGQCNGAQEGSN
STSGFLKTAVQGPTVLMVKNNRITIPANYSAKFMGFKMVDGKQHIVIKLLPTTKPNPCVP
GSQSGAARDSTAVLQPQTLDATAFLTGVPAELNDTVCMKAAPPFSSSSPVLSGKVISEKE
MALLSQTSNIIPAVDDEKGVSPSPVESDLITASVNLTTKVETRDNVDLWGSHITQCHPEV
LGTTVKSPDKVSCTAKPNSYNSGDMHNYCINYINSELPVESSSQGSLPFHNYSKVNNSNK
RRRFSGTAMCENPQRESSSSKTVLSESVLSPVKKESSNPDSRLASISLLNSKDGTLKTQA
EIEEQCVLEKGQNIDGQNLYTNENKSSESMTEKPKWDGISNVESPMMPRITSVFSLQSQQ
ASELLPPELNQLLLDVLKAKPDVKQDSSNIPDKDVPLQCAQSFQEHGGENKIVESSKDLK
VQGLFPIPSGSMGTSRPTDDLNLNCSGKEKQLLSQDVRDSKTPRSFGFGTLPKTQSDAII
TQQLVKDKLRATTHSFYVHNPLNSEPRKAVFVQTPKCFLVPMHFTNKPRFHVSRRPLVNT
QGIPAPLLLNKKPGMILTFNNGKLEGVSAVKTESAQACGTTTKEPCRAPFLKVEQNSNCL
TPALCSSIGSCVSMKSSPENTLSFKGPYIIKTPANSSVKAVPTHIIPEHQGTKLNISDSV
KPQNKIFPKPPLYTFLPDGKQAVFLKCVMPNKTELLKPKLVQNSTCLKNIQPKKPEGTPQ
KILLKIFNPVLNVTAASNLSVSNTGSSLQKDSVPSNQTTGQQKEPESSRDALPFLLDDMM
PANEIVITSTATCPESSEEPICITDHSEARVLRCKTNCTIERNFNKKNTSKRKVSRIKNH
VRSQDSETAFVSRSRNCKRKCRDSYQEPPRKKALHRKCKEKAKPESIPESFEFNRPRLSK
DTVRTLRLFPFSSKQLVKCPRRNQPVVVLNHPDADSPEVVNVMKTVAKFNGRVLKVSLSK
RTIDALLKPVCCNPSETTYDDFPKRHKTFKPVSSVKERFVLKLTLKKTSKNNYQIVKTTS
ENTLKAKFNCWFCGRVFDNQDAWAGHGQRHLMEATRDWNMLE
Download sequence
Identical sequences E1BG18
ENSBTAP00000049132 XP_002698453.1.76553 XP_015325018.1.59421 XP_015325019.1.59421 XP_015325020.1.59421 XP_015325021.1.59421 XP_015325022.1.59421 XP_015325023.1.59421 XP_015325024.1.59421 XP_015325025.1.59421 ENSBTAP00000049132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]