SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015326941.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015326941.1.76553
Domain Number 1 Region: 122-564
Classification Level Classification E-value
Superfamily Sema domain 1.83e-113
Family Sema domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1415-1544,1721-1907
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.04e-48
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 903-997
Classification Level Classification E-value
Superfamily E set domains 1.03e-16
Family Other IPT/TIG domains 0.0055
Further Details:      
 
Domain Number 4 Region: 994-1084
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000229
Family Other IPT/TIG domains 0.057
Further Details:      
 
Domain Number 5 Region: 569-618
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000162
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 1082-1194
Classification Level Classification E-value
Superfamily E set domains 0.0000662
Family E-set domains of sugar-utilizing enzymes 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015326941.1.76553
Sequence length 1940
Comment PREDICTED: plexin-B2 isoform X2 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MQAYTPSGPVCTGVLGLGLGGQCLGGAEGGMEEAGETESPPGWQRPAGAPRAAPRTPDVE
AGAKLVVRPPSLLCFLENLNVGLEQRLSRTTEAWGAGAMALQLWALALLGLAGTSASLRP
RKLDSFRSETELNHLVVDEASGMVYVGAVNMLYQLSADLQLEQRVATGPALDNKKCTPPI
EVSQCHEAVQTDNVNQLLLLDPPRSRLVECGSLFKGICALRALGNISTRLFYEDGSGEKS
FVASNDESVATVGLVSAADPGGERLLFVGKGNGPHDNGVIVSTRLLDRTEGREAFEAYTD
HATYKAGYMSSNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCKQDPFYYSYLEV
DLSCLDPGDAQAPAFGTCLAASLDRPGSGGVLYAVFSTDGRGGRGPRTGLCLFPLDEVHR
RMEANRDACYTGAREVARDTFYKPFHGDIQCGGHVSGASKSFLCGSEHLPYPLGSHDGLS
VKAVLHRGGLNLTAVTVTTENGHTIAFLGTSDGRVLKVYFAPDGSSTEYGAILVEINKRI
KRDLVLAADLASLYAMTQDKVFRLLVQECASFSSCAHCQSSQDPYCGWCVVEGRCTRKAE
CPRADESGHWLWSRNESCVAVTGAHPQNMSRQAQGEVQLTVSPLPALRDDDTLLCLFGGS
PPHPARLQEGAVVCNSPSRSSLPRTPPGQDHVAVTIRLHFKRGNVFLTSHQYPFYDCREA
MSLQENLPCISCSSNRWTCQWALLEHACQQASPGPEDGVVGAHMEDDCPQFLNPSPLVIP
VNHETDVTFQGKNLDTVQGSPLLVGSDLLKFEALVSTQEPGTFSFRTPKLTHDANETLPL
HLYVKSAGKNVDSRLQVTLYNCSFGRSDCSLCLAADPAYRCVWCSGRSRCVYEALCSNAT
SECPPPVVTRIQPETGPLGGGIRVTILGSNLGVRADDVKRVTVAGQNCAFEPERYSVSTR
IVCTIEAAEEPCTGGVEVDINGKLGHSPPHAQFTYQPQPHSVEPKQGPQAGGTTLTINGT
HLDTGSEEDVRVTLSDVPCNVTQFGAQLQCVTGPQAVPGELALKIYYGGSEVPNPGITFT
YRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQRFAMVVIAEPLQSWRRRRETGPLRSV
TVVGTEYVFYNDSKVVFLSPAVPEEPEAYNLTALIRMDGHQALLRTEAGAFEYVADPTFE
NFTGGVKKQVNKLIHARGTNLNKAMTIHEAEAFVGAERCIMKTLTETDLYCEPPEVQPPP
KRRQKRDTAHNLPEFIVKFGSREWVLGRVEYDTRASDVPLSLILPLVIGPMVAVIAVSVY
CYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEAGIPVLDYK
TYTDRVFFLPSKDGDKDVMITGKLDIPESRRQVVEQALYQFSNLLNSKCFLINFIHTLEN
QREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVE
RMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDV
EYTPLTVSVIVQDEGVDAVPVKVLNCDTISQVKEKIIDQVYRTQPCSRWPKADSVVLEWR
PGSTAQILSDLDLTSQREGRWRRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGER
HALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDN
FFQSVLAPGNAVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNPHF
IFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKG
IRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKM
QLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences XP_015326941.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]