SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015329140.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015329140.1.76553
Domain Number 1 Region: 742-886
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-38
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 1712-1868
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-37
Family Spectrin repeat 0.00000139
Further Details:      
 
Domain Number 3 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-37
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 1819-1974
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.00000204
Further Details:      
 
Domain Number 5 Region: 521-673
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-33
Family Spectrin repeat 0.0000565
Further Details:      
 
Domain Number 6 Region: 1287-1430
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-33
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 7 Region: 1499-1654
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-33
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 309-459
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-31
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-30
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 10 Region: 1924-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-28
Family Spectrin repeat 0.00096
Further Details:      
 
Domain Number 11 Region: 2086-2199
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 12 Region: 2308-2465
Classification Level Classification E-value
Superfamily EF-hand 5.98e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 13 Region: 2201-2316
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 14 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 15 Region: 1057-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 16 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 17 Region: 472-538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000023
Family Spectrin repeat 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015329140.1.76553
Sequence length 2472
Comment PREDICTED: spectrin alpha chain, non-erythrocytic 1 isoform X7 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLHQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMYRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVDHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWESLKSKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRVTKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDESDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDVLDQERADLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQSFADQLIAGGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIDRG
ACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL
LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRD
AINGRFQKIKSMAASRRARLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQ
NLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAA
ARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFT
VHKDRVNDVCTNGQDLVKKNNHHEENISSKMKGLNGKVSDLEKAASQRKAKLDENSAFLQ
FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK
DQLLAAKHVQSKAIEARHAALMKRWSQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKA
SAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSF
RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQW
IQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDN
KYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKS
GRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRET
ENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAF
DYVEFTRSLFVN
Download sequence
Identical sequences E1BFB0
NP_001107628.1.59421 NP_001107628.1.76553 XP_015329140.1.76553 ENSBTAP00000020395 ENSBTAP00000020395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]