SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015329911.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015329911.1.76553
Domain Number 1 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 168-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 129-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 336-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000104
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015329911.1.76553
Sequence length 529
Comment PREDICTED: zinc finger protein 572 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEQEQKLLVSDSNGLTKKESLKNTITGDESKNNLKTVQFSNSKADKERASKWSRSDGPEN
YKDEDTKEILLTGSQGGKTERDDSYENDSNLGSQRNCTEKEEEQPNHWGWSPGDHTGPAG
QQNPSFGDKPYKCSECWKSFSNSSHLRIHQRTHSGEKPYRCSECGKCFSNSSHLIQHLRT
HTGEKPYQCGECGKSFSNTSHLIIHERTHTGEKPYKCPECAKSFSSSSHLIQHHRSHTGE
KPYECPLCGKCFSHSYVLVEHQRTHTGEKPYKCPDCGKSFSQSSSLIRHQRTHTGEKPYK
CPECGKGFGCNSTLIKHQRIHTGEKPYQCIECGKNFSRSSNLVTHQKMHTDDKTYQSSEY
EESLSQNYSLIEECRIQPGEKPYKCCECGKSFGLSSHLIRHQRTHTGEKPYRCSECWKTF
SQSSTLVIHQRTHTGEKPYKCPDCGECFSQSFNLIRHRRTHMGEKPYKCTDCEKCFSRSA
YLSQHRKIHVGKSFESPEVEDFPHEWTWKNYSGEIALIPSFSVPSSSPS
Download sequence
Identical sequences F1MXB5
XP_010810271.1.76553 XP_010810272.1.76553 XP_010810273.1.76553 XP_015329911.1.76553 9913.ENSBTAP00000011959 ENSBTAP00000011959 ENSBTAP00000011959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]