SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015330295.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015330295.1.76553
Domain Number 1 Region: 5-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.29e-119
Family Calpain large subunit, catalytic domain (domain II) 0.000000109
Further Details:      
 
Domain Number 2 Region: 354-498
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 8.63e-38
Family Calpain large subunit, middle domain (domain III) 0.00013
Further Details:      
 
Domain Number 3 Region: 520-616
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.36e-16
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015330295.1.76553
Sequence length 640
Comment PREDICTED: calpain-5 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MFSCVKPYENQNYSALKRACLRRKVLFEDPNFPATDDSLYYKGSPGPTVRWKRPKDICED
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGI
FHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSSSRNEFWCALVEKAYAKLAGCYQALDGG
NTADALVDFTGGVSEPIDLTEGDFANDEAKRNQLFERVLKVHSRGGLISASIKAVTAADM
EARLACGLVKGHAYAITDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
EWQKVSKSEREKLGVTVQDDGEFWMTFEDLCRYFTDIIKCRLINTSYLSIHKTWEEARLR
GAWTRHEDPLQNRSGGCINHKDSFFQNPQYIFDVKKPEDEVLISIQQRPKQSTRRDGKGE
NLAIGFDIYKVEENRQYRMHSLQHRAASSIYINSRSVFLRTEQPEGRYVIIPTTFEPGHT
GEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQVTQVHVLGAAGLKDSPTGANSYV
IIKCEGDKVRSAVQKGTSTPEYDVKGVFYRKKPSQPITVQIWNHRVLKDEFLGQVHLKAN
ADDLQALHTLHLRDRNSRQPSDLPGTVAVRVLSSASLTAV
Download sequence
Identical sequences F1MQD1
ENSBTAP00000006638 XP_005216345.1.76553 XP_005216346.1.76553 XP_015330295.1.76553 ENSBTAP00000006638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]