SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015332418.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015332418.1.40921
Domain Number 1 Region: 61-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-32
Family Glutathione peroxidase-like 0.000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015332418.1.40921
Sequence length 215
Comment PREDICTED: peroxiredoxin DOT5 [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV
NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE
LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF
VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE
Download sequence
Identical sequences N1P967 P40553
YIL010W NP_012255.3.97178 XP_015332418.1.40921 YIL010W YIL010W 4932.YIL010W YIL010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]