SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015333840.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015333840.1.40921
Domain Number 1 Region: 891-945
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 975-1030
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000068
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 521-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000307
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 728-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000106
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 936-977
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000688
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 6 Region: 1020-1071
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000861
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 7 Region: 818-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000201
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015333840.1.40921
Sequence length 1331
Comment PREDICTED: PR domain zinc finger protein 15 [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MVGCTPFSPSCMVRVCEREPAFAVCQALHPGCPRSVGWMSSSGPQLPVATNSSGGGFSEA
LLLSAWCALSVLALLGLLVVQQSGLQVTGHLAQASETSTSDERHGSGATALSATDLPSGT
IWVLAPTTLGRKDTCTRDLPLRRVCTGVKMAEDGSEEIMFIWCEDCSQYHDSECPELGPV
VMVKDSFVLSRARSSLPSNLEIRRLEDGAEGVFAVTQLVKRTQFGPFESRRVAKWEKESA
FPLKVFQQDGHPVCFDTSNEDDCNWMMLVRPAVEPGHQNLTAFQHGSDVYFTTSRDIPAG
AELRVWYAAFYAKKMDKPMLKQACSSVHAVGTPEHSGPVESERSPWACKVCSSAFLELQL
LNEHLLGHLEQAKGLPAGSQHEAAPEKEPQPPRVQPPAVPESASVQSRATKEQKKKPRRG
RKPKASKPEQPLVIVEDKEPAEQVAEIITEVPPDEPVSATPDERMVELVLGKLAPHTHDG
STVPKFTHHQSSTIALKRSLVLSSRHGIRRKLARQLGEHKRVHQCGICSKVFQNSSNLSR
HVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRNEVDGEYRYRCGTCGKTFRMESALE
FHNCRTGLIANPGEGGTSGNRLRDLPGTREGRAGGHGGVLQCPEMPAACLVAPQARPARS
AQGAAGPSSEDIPARCPAGRAGHAPPHLLLVCSLCLVGVSGISGVRRVKREDLEAGGESL
VRYKKEPSGCPVCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKD
IALMDDHQREEFIGKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEV
HKEKGYGCSTCHRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERH
KLIHTGVKSHACEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLH
KGIKEYECKECHRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGK
QWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAV
RIDDLDHLPETTTIDASSIGIVQPELNLEQEELAEGKPGKTAKRSHRRKQKPEEGAGAPA
PEDTAFSEYSEKEAEFTGSVGDETSSAVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPI
TTAAGTQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQHDVQVHPPPE
ASSPQSVAHFINLTTLVNSITPLGSQLSEQHPLTWRAVPQTDVLQPPQPPAPPQQAAQPQ
VQAEQQQMYSY
Download sequence
Identical sequences XP_015333840.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]