SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015347464.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015347464.1.40921
Domain Number 1 Region: 192-268
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015347464.1.40921
Sequence length 310
Comment PREDICTED: upstream stimulatory factor 1 isoform X1 [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP
RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN
Download sequence
Identical sequences A0A096N9M5 A0A0S2Z4U5 A0A1U7UFP6 A0A287CV93 A0A2K5KP75 A0A2K5RNH4 A0A2K5WZA6 A0A2K5ZKN7 A0A2K6C7J7 A0A2K6EJS8 A0A2K6LW25 A0A2K6QMZ6 G3QMW3 H2N528 H9FZC2 K7BZZ6 P22415 U3FX38
NP_001263302.1.87134 NP_001263302.1.92137 NP_009053.1.87134 NP_009053.1.92137 XP_003785833.1.62490 XP_003811906.1.60992 XP_003949666.2.37143 XP_004027784.1.27298 XP_004589151.1.84141 XP_005341877.1.77405 XP_005341879.1.77405 XP_005541284.2.63531 XP_005541287.1.63531 XP_007974643.1.81039 XP_008064112.1.4292 XP_010365401.1.97406 XP_010365402.1.97406 XP_010365403.1.97406 XP_011768422.1.29376 XP_011831806.1.47321 XP_011922960.1.92194 XP_011922961.1.92194 XP_012495038.1.63892 XP_012495039.1.63892 XP_012623977.1.48125 XP_012623978.1.48125 XP_012623979.1.48125 XP_013221417.1.77405 XP_013221420.1.77405 XP_014969178.1.72884 XP_015347462.1.40921 XP_015347463.1.40921 XP_015347464.1.40921 XP_015347465.1.40921 XP_015347466.1.40921 XP_016786202.1.37143 XP_017370560.1.71028 XP_017716328.1.44346 XP_017716329.1.44346 XP_017716330.1.44346 XP_017821895.1.60252 gi|6005934|ref|NP_009053.1| ENSPPYP00000000720 ENSP00000356998 ENSP00000356999 ENSP00000357000 GO.35415 ENSP00000356999 ENSP00000357000 ENSPPYP00000000720 9600.ENSPPYP00000000720 9606.ENSP00000356999 ENSGGOP00000003861 ENSGGOP00000003861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]