SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015359843.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015359843.1.40921
Domain Number 1 Region: 143-320
Classification Level Classification E-value
Superfamily MIR domain 5.06e-51
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1007-1120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-18
Family SPRY domain 0.029
Further Details:      
 
Domain Number 3 Region: 3921-3999
Classification Level Classification E-value
Superfamily EF-hand 0.000000000763
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 4 Region: 585-733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 27-108
Classification Level Classification E-value
Superfamily MIR domain 0.0000034
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 349-474
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000405
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2069-2134
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000968
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015359843.1.40921
Sequence length 4880
Comment PREDICTED: ryanodine receptor 2 [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MLANTVEKSEGKFMMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDV
GLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAF
QQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAV
SVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKSLLLMDKEKADVKST
AFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTYQSVDVKSVRMGSI
QRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKAKAPAVDL
PIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMISLVLECIDRLHV
YSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEA
SSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRS
NQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVT
AEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQH
LLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGR
HGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPV
DTTQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQ
ERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIK
LTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNK
DSLREAVRTLLGYGYNLEAPDQEHAARAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEA
VTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVD
MNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYF
TICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQ
KSFGSQNSSTDIMFYRLSMPIECAEVFSKTVAGGLPGAGLFGPKNDLEDYDDSDFEVLMK
TAHGHLVSDRGDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTED
VLADDRDDYDFLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVT
LGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAATGLLTFIANGKELS
TYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHV
QFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQE
ELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLID
IHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSF
VSISNEFYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTL
LIMGVFHNEDLKHILQLIEPSVFKEAVTPEEEGHTLEKELSAEDSKLEGAGDEGGKRPQE
GLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQAL
NMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIEL
DEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKPVESDSKKSSSLQQLISETMVRWAQ
ESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLS
VRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPK
MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNN
ELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGE
SVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKT
LDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGD
LVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVG
FLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHT
VYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLT
NHYERCWKYYCLPGGWGSFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSA
VAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDK
WSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIER
TREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNI
WAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSRGFKDLE
LDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLI
DQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVN
CLHILGQTLDARTVMKTGLEGVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVT
QIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ
RSALGECLAAFAGAFPVAFLETHLDKHNPYSIYNTKSSRERAALSLPASVEDVCPNIPSL
ERLMEEIVELAESGIRYTQMPHVMEVVLPMLCSYMSRWWEHGPESNPERAETCCTALSSE
HMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAA
MVVSEEDHLKAEARGDMSEAELLVLDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPE
AEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLIADTKSKMSKAAVSDQERKK
MKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRN
NIHLQGKLEDPAIRWQMALYKDLPNRAEDTSDPERTVERVLDIANVLFHLEQKSKSVGRR
YYSLGSTVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSW
IETEEHYFEDKLIEDLAKPGAEPPEEDDVAKRVDPLHQLILLFSRTALTEKCKLEEDFLY
MAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASK
GETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAF
ERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTV
NIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPC
TGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEG
NVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDF
HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDISFNVAVLLTNLSEH
MPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKES
KRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEDSEKDRPEE
QGPRMGFFSILTVRSALFALRYNVLSLMRMLSLKSLKKQMKKVKKMTVRDMVTAFFSSYC
SVFLTLLHFVASVCRGFFRIVCSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEE
GEKKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLGDLMSS
PVPLPEVQEKFQEQKAKEEEKEEKEETKSEPEKAEGEDGEKEEKTKEEKGKQKLRQLHTH
RYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVA
EGKELPTRSSIENSKVTTSLDSSSHRITAVHYVLEESSGYMEPTLRILAILHTVISFFCI
IGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDK
FVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQM
WKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQL
VLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGI
GDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETK
CFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQER
CWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_015359843.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]