SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015361780.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015361780.1.40921
Domain Number 1 Region: 139-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-27
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 501-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 363-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 195-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 557-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 24-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 9 Region: 85-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 447-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-18
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 12 Region: 602-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000059
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015361780.1.40921
Sequence length 658
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 420-like [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MAGICGDPSSPSSWTSRMCGKQHESLAFRDVAIDFSEEEWKCLEPAQQNLYRDVMLETYR
NLIFLDTEFWKVWNTHNETSNTSNQVSTLTKHQRIHTRKHPYKCEECGKGFNKSSQLNQH
HTIHTGEELYKCKECGKGFTQKGSLTQHQRVHTGEKPYKCEECGKAFTQRGSLTQHQRIH
TGEKPYKCDVCGKCFTKRSYLTHHHRIHTGEKPYKCNECGKAFNKRDQLTMHHRIHSGER
PYSCETCGKGFTQRSCLNQHQRIHRREKPYNCETCGKGFAQRCYLAQHQKIHSIEKLYKC
NECGKGFTHKGSFTEHQRIHTGEKPFKCEECGKGFTHRGSLPQHQRIHTGIKPYKCDVCG
KCFTKRNYLPQHQRIHTGEKSYQCNECGKAFNKRDQLTIHKRIHSGEKPYSCETCGKGFI
QRAKLILHQRVHSGEELYKCNECGKGFNLRAWLTQHQKIHTEPYKCDVCGKCFTHRYYLA
QHQRMHTGEKPYKCEECGKCFIMRAHLTQHQIIHTGEKPYKCEECGKCFTMRAHLTQHQI
IHSGEKPYKCEECGKGYSHRQYIIRHQKIHSGEKPYECEECGKCFTMRAHLTQHQIIHTG
KKPYNCEASGKGFTKRACLLQHQGIHTXKYCYKCEECGKAFNQKPHCTQYQRIHNWER
Download sequence
Identical sequences XP_015361780.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]