SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015363092.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015363092.1.40921
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 540-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 6 Region: 3-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-19
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 7 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 208-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 600-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000273
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 154-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000204
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 100-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015363092.1.40921
Sequence length 700
Comment PREDICTED: zinc finger protein 14-like [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MISVTFEDVAVNFMQEEWALLDSSQKNLYRDVMLEVLRNLASIGNKCDEKNFEDQIKHSG
SNVRQITSHYGHERYKHEECEEKPCELKQYRKSLVSLKSVHTQMLTQTGDGTYENTVCGK
VISCSNDIQRHEDSHTGWQPDECQQCDEVSSLTGVQRHTRTHSGGKHFQCEVCGKAFHSP
TLYRKHETTHSGEKSHECKEGGKTLVSPTSLHSHVITHTGKVLFKCNVCGKDFAYRSLFR
IHQRKHTREKPYECQQCGKSYTTSSYLQIHEQIHTGENPNECQQCGKVFTTSFSLHRHER
THTGEKPYECKQCGKAFAQSSNLHSHEKTHTGEKPYACQQCGKAFSTSSYLQIHERTHTG
EKPYECKQCGKAFTQSSSLHSHKKTHMKKKPYECQQCGKACTTLSYLQIHEQIHTGEKPN
ECQQCGKVFTTSFSLHRHERTHRGEKPYQCQQCGKVYTTAFYLHIHEQTHSGVKPYECKQ
CGKAFARSSQLHKHEQTHTGGKPYECKQCGKAFAESSQLHKHQRTHTGEKPYECQQCGKA
FAKSSHLKRHGRTHTGEKPYECKQCGKAFAQSHHLHRHEKKHTGEKPYEYQQCGERLDTS
SEPHIHGRIHAEEKPNEYQQCGKIFISSFFLHRHEGTHTQEKPYECKQCGIAFTQSSHLC
SHERTHTGEKPYECQQWGKAFVISHQLHLHEQTHIAKKLC
Download sequence
Identical sequences XP_015363092.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]