SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015363543.1.48343 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015363543.1.48343
Domain Number 1 Region: 52-513
Classification Level Classification E-value
Superfamily Sema domain 9.94e-114
Family Sema domain 0.000098
Further Details:      
 
Domain Number 2 Region: 1396-1520,1710-1894
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-43
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 864-954
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000204
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 4 Region: 959-1043
Classification Level Classification E-value
Superfamily E set domains 0.00000000000522
Family Other IPT/TIG domains 0.049
Further Details:      
 
Domain Number 5 Region: 1043-1119
Classification Level Classification E-value
Superfamily E set domains 0.00000000028
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 6 Region: 515-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000105
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015363543.1.48343
Sequence length 1930
Comment PREDICTED: plexin-B isoform X1 [Diuraphis noxia]; AA=GCF_001186385.1; RF=representative genome; TAX=143948; STAX=143948; NAME=Diuraphis noxia; strain=RWA2; AL=Scaffold; RT=Major
Sequence
MDWKFITVGKLVMPKSKLCFVLVLLLITTTLKCSSAMSVIAKYXQNIQSECFSNHLLHMA
VDKSLGGRVYIGAVNKLIQLEGSNLTVETCANTGPLSDSPQCPASGCPTSPPIETSLTDN
YNKILIIDLESRMLIVCGSIFQGACNKYKMSNVSLPAQFIPMSIAANTEQASTYAFIGPE
HYNNWGYSNVLYVGTTFTNNGDYRHAVPAISSRSLYNLNLAETSFLKQSSLNINVNYRDR
FLVKYIYGFNSSDYAYFVVVQKHSPLPGQEELGYVTRLARVCIDDANYDSYTEVTLQCMV
KETSNSDDLVNYKLAQDLKLSNAGEDLAASLGIDTDDQVLVGSFSPSQGITNEPMPKSAI
CAFSMQYIESKFNENIHMCFNGTIKYRNMPYVSGLILQGNCPTAGSTGNILNFCEIGLKI
SGTEPITTQAAINFPDHLITSITLATTEKNTIIFLGTSTGILKKVLLSSATHAVNYEELI
LDNGNAILPDTSLSTNGEHLYVLTRSNVLKVRVEHCYSFNNCSSCLEANDPYCGWCSLER
RCTVRSTCQKASHSSPRWLSLGTGQQCIDFEQINPDRIPIHQMSKLQLVIKTLPELPVGA
KYRCVFGKSDPLDAVVTQFGLQCSTPSIQSRPKIPKNQDHIYVSLSVRSSETNKDFVSRN
FAYYDCSAHTRCMECVKSQWACNWCVYENKCTNNVSSCQRIIISGENNPTRLKSHGAMFC
PRFVQPAQKILLPNGVPKEIVLQVENLPNPQVGHTGFQCIINIEGAKLMVPARVEEKYIV
CDKTTYSYETNSGEYDAMVSMVWNRNHHVDTINVTLYKCDILGSHREHPDCSLCVTRNRK
YHCTWCLSTCVYSETCSEASSNECPKPRIDMIKPLSGPIEGGTMVTIEGSNLGLNREDVW
GKIHIGGILCHLVDYEVSVKIVCKTGPSNVEKFASIVVGNNAGLTESSVHFSYKSVKLDK
VTPSMGPQSGGTLLAISGHNLNIGSSVTAFLDNFPCTVNTTHASSTRLTCVTSAANRPLT
VNSMHLIIDGSNRTLAKPFTYRSDPTVAEIKPLISFLSGGRMITVHGTNFDIIQKPEMVI
YVDSDFMHPINKTECIVLNSAQMECPSPSANGQFLKNIKSYRKRRRHATNGKYLDSYLTL
KIGFIMDNVAAVKDLEKHLKVLQSQIVYVQDPKYFQFSNTIKSYKGDTLVIEGENLNLAC
DESDVNVTIGMEVCNVTSLANTQLVCIPPQYQPQSIDDFGSPTKTGLPLVVVRVGKKLRF
NVGYLQYDVLSTYSFSPEAIAGAVTXALCIIIIFFIILFLYRRKSTQAEREYKRIQIQMD
TLESNVRSECKQAFAELQTDMTDLTADLESSGIPTLDHNEYILKVFFPGVRDHPILNESK
VVIAGSTTNYDAAMMQFEQLINNKHFVLSFIDTLESQKTFSIRDKVNVASLLMVVLMNKM
EYATDILRSLLLRLIDKSVMSKHPHLMLRRTESVVEKMLTNWMALNMYKYLKDYAGSSLF
LLYKAIKHQVEKGPVDALTYDARYSLSEDRLLREQIDHRVVNLYVMQDELDDKVQCKVLD
CDTISQVKSKILDAVYKNTAFSLRPSVYGVDLEWRHGRGGHLTLQDYDVTTKNLCGWKKL
NTLAHYGVKETAVMTLIPRQHDTYNKSCMQSCHNCTSGYYSGAIISTTNGGIETDSSSNG
TVYHLVRSTDTQQQYHTNKMPERTHKAIPEIFLTRLLSTKGTIQKFVDDFFSTILAANET
LPPAVKWLFDLFDDAAKKYNIIDPEVVHSWKSNSLPLRFWVNFIKNPDFIFDIDKTPTVD
SCLSVIAQTFMDSCSTSDHRLGKDSPSNKLLFAKDIPQYRETVLRFYSDIQKLPQITDQE
LSTTMQQLSVSHFGQFHIVSALKELYIYASKYNDAILDSLEMDPYCQKINLSHKLNKVAG
TLEGDEAAIC
Download sequence
Identical sequences XP_015363543.1.48343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]