SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015369394.1.48343 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015369394.1.48343
Domain Number 1 Region: 430-642
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-54
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 194-322
Classification Level Classification E-value
Superfamily BRCT domain 9.74e-19
Family DNA topoisomerase II binding protein 1, TopBP1 0.054
Further Details:      
 
Domain Number 3 Region: 138-221
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000305
Family DNA ligase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015369394.1.48343
Sequence length 916
Comment PREDICTED: protein ECT2 isoform X2 [Diuraphis noxia]; AA=GCF_001186385.1; RF=representative genome; TAX=143948; STAX=143948; NAME=Diuraphis noxia; strain=RWA2; AL=Scaffold; RT=Major
Sequence
MEHMSYQLLLWKCIGRGNILRGSGYGETHDEEMADGEVSMNHTGVSSLESELSNFNIYLE
KIYSSDSDVLLAIKKLNVSIKYLENLSDVNLLEKNDILVTTLFEELAVKRPCFRILGRPA
LLELAESPNGLQGINRHRYCNALVGAIVSVTGIQKRDEMARLLSLIRWMGGSFRESINYK
TTHLVSGYACSAKSQYAYLHEIPVIGSSWLHAAWERRDEIDFKAINSSFFSEHKLKPFHG
AKICFSGFTEEERSHMVDVLLQNGGTPISDENDTECTHLVVDESSLDSIPPVKKNNAEIL
KEAWFWTSVQYQSCALTKEYLLTNLNATNTPTSTRVMSSTLTLSSSSRARKRKRHLDRLG
SLLRPSPTPVATIGETSPTNSSGPSKRRSSAANTLDGLRLSCGSFLNFTNSPDHPSPFKL
PKDPDLVIKDKPFSPRYQVFSELLQTEINYVGVLNTIITVYKEPLEEMIDKEDCLLNNTE
IKIIFGNVLPIYQVHQEMLEELKCLATSWQEDSSIGSVFLKYSSELVKAYPPFVNFFEKT
REMLLQCDQTKPRFHAFLKVGQTRPECCRQSLQELLIRPVQRLPSVSLLLNDILKHSDKN
NPDHQALVSALASIREVMTHINEDKRKTEGQVVLFDIFNDIDNCPPHLVSSHRSFISKCD
VVELSDNLSGRGDHLTIFVFSDVVEVCKKRKSFNGKSPKEPNSGSHKLNGGAKSYKHIKL
MPLNIIKQVIDIKETEDCRNTFSLMIIDNHDFKERLYTFTMTGSNCSANHKNIFLKNISQ
QVANTVCSGNILVSLDSQQLDIDTSEITTGTLGKAFKFASRTRIKVGRALSFNKTPSKLK
RAVSTMMSPVLSLTNNGGLGTHALTPSTQLANMHLASCTNLNEMSSDDHTFPSPPLSVQP
NRKNKTSILSLSSAPR
Download sequence
Identical sequences XP_015369394.1.48343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]