SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015394711.1.5354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015394711.1.5354
Domain Number 1 Region: 130-307
Classification Level Classification E-value
Superfamily MIR domain 3.75e-50
Family MIR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 991-1104
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.88e-18
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 3902-3980
Classification Level Classification E-value
Superfamily EF-hand 0.000000000756
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 572-720
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 14-95
Classification Level Classification E-value
Superfamily MIR domain 0.00000353
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 337-461
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000235
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2057-2122
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000955
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015394711.1.5354
Sequence length 4860
Comment PREDICTED: LOW QUALITY PROTEIN: ryanodine receptor 2 [Panthera tigris altaica]; AA=GCF_000464555.1; RF=representative genome; TAX=74533; STAX=9694; NAME=Panthera tigris altaica; AL=Scaffold; RT=Major
Sequence
MMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWW
TIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSG
SEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETL
RVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDV
GVRKEVDGMGTSEIKYGDSVCYIQHINTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMD
DGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKASTVDLPIESVSLSLQDLI
GYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGR
EGGEAWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLV
ESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGR
DLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWAST
EGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLD
LSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYA
PCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLER
IREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETL
KTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLA
ENAHNVWARDRIRQGWTYGIQQDVKNKRNPXXXXLDDRTKKSNKDSLREAVRTLLGYGYH
LEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQ
PDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILL
DDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNT
NRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGAQNSTADIMFYR
LSMPIECAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDK
EATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQT
STYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRS
NCYMVCAGESMSPGQGRNNNGLEIGCVVDAASGLLTFTANGKELSTYYQVEPSTKLFPAA
FAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQF
LKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSA
VCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNS
EFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRIQFSSPSFVSINNECYQYSPEFP
LDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNDDLKHIL
QLIEPSVFKEAATPEEDTEALEKEPSMEDSKPEGAGEEEAKGGKRPKEGLLQMKLPEPVK
LQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTK
EFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDL
TIRGRLLSLVEKVTYLKKKQAEKPVESGSKKSSTLQQLISETMVRWAQESVIEDPELVRA
MFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMI
RGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYF
CRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLE
KVVRYLAGCGLQSCPMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRL
LIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKTLETEQEEDDTIH
MGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP
TIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLD
TAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTK
AQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCL
PGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMES
NYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIY
GEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRVERTREGDSMALYNR
SRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESK
GGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAY
SFLQQLIRYVDEAHQYILEFDGGSRSKAEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFL
SAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDAR
TVMKTGLESVKSALRTFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLP
MLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFA
GAFPVAFLETHLDKHNIYSIYNTKSSRERAALNLPTNVEDVCPNIPSLEKLMEEIVELAE
SGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKI
IYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAE
ARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEDLFRMVAEVF
IYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSTQT
SLIVAALKRLLPIGLNICAPGDQELIALAKNRFSMKDTEDEVRDIIRSNIHLQGKLEDPA
IRWQMALYKDLPNRTEDTSDPEKTVERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQR
KRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGADPPEEE
EGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFE
VTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGDTGPMVAATLKLGIAILN
GGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGE
KVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISD
FYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGF
LHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESS
NNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLL
SCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLN
YFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKME
LFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKEKPEEQGPRMGFFSIVTVKSALFA
LRYNILTLMRMLSLKSLKKQMKKVKKMTMKDMVTAAFSSYWSIFMSLLHFVASVSRGFFR
IICSLLLGGSLVEGAKKIRVAELLANMPDPTQDEVRGDGEEGDRRPMEAALPSEDLTDLK
ELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPDVQEKFQEQKVKEE
EKEEKEESKSEPEKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAY
QQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKEPPTRSSSGNAKVSSL
DSGSPRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVA
RKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRIS
ELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMT
MSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFN
FFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFD
ITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFET
HTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_015394711.1.5354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]