SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015396339.1.5354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015396339.1.5354
Domain Number 1 Region: 175-429
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-64
Family Eukaryotic proteases 0.000000142
Further Details:      
 
Domain Number 2 Region: 58-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 134-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000392
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015396339.1.5354
Sequence length 433
Comment PREDICTED: complement C1r subcomponent-like protein isoform X2 [Panthera tigris altaica]; AA=GCF_000464555.1; RF=representative genome; TAX=74533; STAX=9694; NAME=Panthera tigris altaica; AL=Scaffold; RT=Major
Sequence
MGQASQMSSSRCLVSEWGNYLWRSPHSTSCQGKMWWLLLWGVLQACPTQGSVLLAQQLPQ
QLTSPGYPEPYVKGQESSSDIEAPEGFAVRLVFQDFDLEPSQDCGQDSVTVSCGVNHSRP
SGGSEAISIAEDNSSKIQNHCQEPYYQAVPAGALPCTTQGLWKETQDREELPRCEPVCGR
PLTPIAQNQEALDSSKAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSVFPW
KNRRVDVFLGHTSLDEMLRLGSHPVRRVVVHPDYRQNESHNFNGDIALLELQHSVPLGPS
LLPVCLPDSETLYRSGMLGYVSGFGVERGWLTTELKYSRLPVAPRAACQAWLQEKQRSEV
FSDNMFCAGDEMRHQSVCQGDSGGVYVVWDERAHHWVATGIVSWGIGCGKGYGFYTKVLN
YLDWIKGVMGGKD
Download sequence
Identical sequences XP_015396339.1.5354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]