SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015399409.1.5354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015399409.1.5354
Domain Number 1 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-22
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 12-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 299-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000652
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 639-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000558
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 192-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000312
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 497-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000202
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 110-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000204
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015399409.1.5354
Sequence length 697
Comment PREDICTED: zinc finger protein 77-like [Panthera tigris altaica]; AA=GCF_000464555.1; RF=representative genome; TAX=74533; STAX=9694; NAME=Panthera tigris altaica; AL=Scaffold; RT=Major
Sequence
MMELCCNRVCGMFQASVVFEDVAVKFTPEEWALLDRGQRKLYRDVMLETCRNLSSVEKQK
FHSNGDLTRKQEGLLSSPLLESVCERIEGDQCGETLNPITSLTVHEGCPTGGKSCECTKC
REAFADGSFLEKPRRPHPRLKPSPGEECGQACSSVTSLNTHVDTDLVEKPCEGQVTGRAS
ETYAKSLRSKKSIECKKCGKTFTCTASFKRHVQGHCGQRVHVCDTCGKTFVYHCYLTRHV
RIHTGVRPYECQECGRAFGYKSSLQNHVRTHAREKPYKYQPGGKAFPGQHSFRIPERKHT
GYAPFECKECGKTFKKRLHFECHMTTHNVVKPYECLECGRAFRHHSDLRVHMRTHTGERP
YECKGCGKSFRKYHHIKRHMVIHSIVKPYECKECDRGFGDQTHLRIHMRTHTGERPYECK
QCGKAFRYQWNLRGHVTTHTRERPYECPECGKAFRYKSCLQEHVTTHTGEKPYECQECGK
AFRYKSCLREHMRRHTGERPNKCQHCGKAFLRHYTLVLHIMRRHSGDGHLECKECGETFR
KHRPFERHMTTHNVVKPYECEECGKTFRYHRDLRIHVRTHTEEKPFKCQHCGKAFPSPSN
LGVHMRTHSGGRSYECQRCGNAFTSPASLRAHMRTHAAERPFECIECGKAFNQLQIFQSH
LKTHSTIKSYECKKCGKVYKFSSSLRAHMKKHPGERP
Download sequence
Identical sequences XP_015399409.1.5354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]