SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015414633.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015414633.1.95426
Domain Number 1 Region: 90-183
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-21
Family DEATH effector domain, DED 0.0097
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000436
Family DEATH effector domain, DED 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015414633.1.95426
Sequence length 242
Comment PREDICTED: CASP8 and FADD-like apoptosis regulator isoform X7 [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MFAEVIHQIDEALDEDEREMLLFLCRDVVADVSAFNVRDLLDSLNERGKLSHMGLAELLY
RVRRFDLLKRILKMDKRAVEAHLLGHPHLVSDYRVLMTEIGDHLDKSDMSSLIFLMKDYM
GRGKTAKDKSFLDLVMELEKLNLVAPDQLELLEKCLKNIHRIDLKTKIQKYKQSAQGAET
SYVNGLQASLPNLSIKDPSYNLRLQWRNCHLKAERIRWLTVCGMCTLHRTCHLRRKASEW
EE
Download sequence
Identical sequences XP_015414633.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]