SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015418431.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015418431.1.95426
Domain Number 1 Region: 38-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 246-360
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000196
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 449-486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 159-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 205-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 410-447
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015418431.1.95426
Sequence length 637
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X5 [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MTVKKKPEVNIVLTGRLSSAVPALGEASTSPPLLTAACSGKLEQHTERRGVIYSPAWPLN
YPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIP
PAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQC
NTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDCGDGSD
EAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDTRRVLLQLELRLGYD
DYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVK
GYCLPWEQPCGSSIEGDMGDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEG
GSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSD
EHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFV
RREAPPSYGQLIAQGLIPPVEDFPVYSASQPPTHPPGLRATEPSHSHAATDAQACLPQRT
LPPPARSPVEPALPPASGTARTDPTADCCAHLTDSVG
Download sequence
Identical sequences XP_015418431.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]