SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015425387.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015425387.1.95426
Domain Number 1 Region: 668-814
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-38
Family Toll/Interleukin receptor TIR domain 0.0000439
Further Details:      
 
Domain Number 2 Region: 31-241,322-384
Classification Level Classification E-value
Superfamily L domain-like 2.82e-37
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 3 Region: 397-631
Classification Level Classification E-value
Superfamily L domain-like 4.76e-37
Family Ngr ectodomain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015425387.1.95426
Sequence length 839
Comment PREDICTED: toll-like receptor 4 [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MWPTRLAGALLPAMAFLSCLRPESWEPCVQVVPNDTYQCMELNLYKIPDNIPTSIKNLDL
SFNPLRHLGSHSFSNFSELQVLDLSRCEIQKIEDDAYQGLKHLSILILTGNPIQSLAPGA
FSGLPSLQTLVAVETNLASLEDFPIRHLKTLKELNVAHNLIDSFKLPDYFSNLPNLEHLD
LSNNKIRNIYHEDLQVLHQMPSFKLSLDLSLNPLDFIQPGAFEKIKLHELTLRSNFDSPE
VMKMCIQGLAGLKINRLILGEFKNERTLVNFNNSALEGLCNLTIEEFRIARFNEFPGDDL
GFLNCLADASTISLVSLYLDKLKIFLEDFKWQYLKLSKCKFEHFPTLDLTFLKQFIFTAN
KGITTFTEVNLPNLEFLDLSRNGLSFKSCCSHRDFGTTRLKHLDLSFNNIIIMTSNFLDL
EQLEHLDFQHSTLKQASDFSVFLSLKNLLYLDISYTNTKIVFLGIFDGLISLQVLKMAGN
SFQDALLPNIFRDLTQLTVLDLSQCQLERVSQEAFGSLLRLQVLNMSHNHLLSLDMLPYK
NLSLRVLDCSFNRIVAANGQELQHFPSNVTSLNLTQNNFACVCEHMRFLQWVQDHRRILV
GAEHMMCEKPLAMQGVPVLSFRNATCQMSKTIISASVLSVLVVSVAVVLVYKFYFHLMLL
AGCKKYGKGESTYDAFVIYSSHDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAAN
IIQEGFHKSRKVIVVVSQHFIQSRWCLFEYEIAQTWQFLSSHAGIIFIILQKVEKSLLRQ
QVELYRLLSRXTYLEWEDSVLGRHIFWRRLRKALLDGKPWSPEGTEGAESSQDEATTST
Download sequence
Identical sequences XP_015425387.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]