SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015444724.1.64745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015444724.1.64745
Domain Number 1 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-22
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-21
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 
Domain Number 4 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 180-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 584-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 543-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 290-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000102
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 505-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000451
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 85-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000017
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015444724.1.64745
Sequence length 665
Comment PREDICTED: zinc finger protein 14-like [Pteropus alecto]; AA=GCF_000325575.1; RF=representative genome; TAX=9402; STAX=9402; NAME=Pteropus alecto; AL=Scaffold; RT=Major
Sequence
MEDLVAFEDVAVNFSLEEWALLDSLQKELYRDVMRETFRNLASVGKKWEDHDIEDQYKNR
VRKLRSLILERHCEGEKSSQCGGNFSLISNLNLKKKILFGRKPQKNSVCGKVFMHHSSHS
KHIRCHTGYKPFEYQKYEEKPYKCNICGRAFSYVQCFEKHERKHNGEKTYKCKECGKAHS
SSTSLQIHERSHIGDKLFECKQCGKAYRYYSALQTHERTHTGQKSYECKQCGKAFSSHLG
FQIHERSHTGEKPYECKKCSKAFSCLSYLRSHEKIHTVEKPYECKECGKAFRYYHNYQTH
ERKFTGERPYECKECGKAFRCYQSFQKHERIHTGGKPYECKECGLAYRYYSTLQRHKRTH
TGEKPYKCKQCGKAYRGHSALQTHERTHTGEKPYDCKECGKVFISHLGFQIHERSHTGEK
PYECKQCSKSFSCVSYLRRHEKIHTGEKPYECKQCGLAYRYYSTLQRHERTHTGEKPYEC
KECGLAYRYFSTLQSHERIHTGEKPYVCKECGKTFRWYQSFQTHERNHTGEKPYVCEKCS
KQFSCLRYLRKHERNHTARKRYECKNCNKAFRYPSDLQKHERNHTGEKPFECKQCGKAYK
DQSSLQTHERTHTGEKPYECKECGKAFIYHTTFRRHMTTHTGEKPRKVQNLGKASVIPFP
FESMK
Download sequence
Identical sequences XP_015444724.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]