SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015445689.1.64745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015445689.1.64745
Domain Number 1 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000517
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 714-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000397
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 550-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000029
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 771-820
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000326
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 394-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000109
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 681-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000017
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 588-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000451
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015445689.1.64745
Sequence length 1031
Comment PREDICTED: zinc finger protein ZFAT [Pteropus alecto]; AA=GCF_000325575.1; RF=representative genome; TAX=9402; STAX=9402; NAME=Pteropus alecto; AL=Scaffold; RT=Major
Sequence
MCKCCNLFSPSQSELLSHVSEKHTEEGVNVDDIIIPLRPLSTPEPTNPSKTGDELSVMKR
KRGRPKGSTKKPSAEEELAENLVRPGEDSLLALADGGGLAASSLECAKCCRKFSNARQLR
KHVCIIVLNLGEDEGEAGNESDLELEKKFKEEDREKAPRRPRTQRTEKAQRTSSSGKEAR
QAAGTKKPIISVVLTAHEAIPGATKIVPVEAGPPEIGATNPEATSADMATRRGYQEYAIQ
QTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAI
KANLNVHLRKHTGEKFSCDYCAFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLI
KHIRDVHDPQDKKVQEALDELCLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDKW
PFACELCGHGATKYQALELHVRKHPFVYVCAVCLRTFVSTIRLRAHIGEAHSAAPEAAVF
ASSINQSFCLLEPGGDIQQEALGGQLQLAEEEFVFQGVNAQEARVLDSLQKRRMDTGLCA
RIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKH
SNILLKCPTDGCDYSTPDKYKLQAHLKVHTELDKRSYSCPVCEKSFSEDRLIKSHIKTNH
PEVSMSTISAVLGRRVQLKGLIGKRAMKCPYCDFYFMQNGSDLQRHIWAHEGVKPFKCSL
CEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDY
TAAQRPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYANVGGGELAAD
ALVQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKLVENEGEPKWEGLVPALQGPGRGGMA
ETAATVRNRDRLDPTAVNILQQIIELGTETHDATAVASVVAMAPGTVTVVKQVTDEEPSS
NHTVMIQETLQQASVELAEQHHLVVSSDEVEGIETVTVYTQGGEASEFIVYVQEAMQPVE
EPAVGQAAQEL
Download sequence
Identical sequences XP_015445689.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]