SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015453976.1.64745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015453976.1.64745
Domain Number 1 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 6 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 600-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 296-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000225
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 87-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000187
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015453976.1.64745
Sequence length 663
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 791-like [Pteropus alecto]; AA=GCF_000325575.1; RF=representative genome; TAX=9402; STAX=9402; NAME=Pteropus alecto; AL=Scaffold; RT=Major
Sequence
MDSVTFEDVAVNFTPEEWALLDPTQKKLYRDVMRETFENLASVGKRVEDYDPEDQYKNHG
RKLRSHIEERIYESEASGQCEKNRSLISNLSPKKKTLPRVKPWEYSVRREVFIQHSSCNR
HIRCHTGHKAYEFRKCGEKPYKCKECSKAFSYLHYFGKSERNLSEEKTYKHKECGKAFSC
SRSPRLHGLTHPGEKPYECKQCSKASKDDCSLKIHERTHTGEKPCECKQCGKSYRDPSSL
KIHERIHTGEKPYECKQCDKAYRDHSSLKIHERIHTGEKPYECKICSKAFTXIPEKPYEC
KQCGKFYRDHSYLQKHKRIHNEEKPYKCKQCSKAFNCLRYLQRHERIHTGVKPYECKQCG
KAFRESRFLKTHERTHTGEKPYECNQCTKAFSCPSSLSKHKRMHTEQKLYKCKECGKAYI
DYXKLQTTGRTHTGEKPYKCKQCSKAFSCVSYLQTHERIHTRGKPYECKQCGKAFRESRF
LKTHERTHTGEKPYECKQCTKAFSCPSSLSKHKRMHTEQKLYKCKECGKAYIDYFKLQTH
GRTHTGEKPYKCKQCSKAFSCVSYLQTHERIHTVEKPYECKQCGKAFRESHFLKSHESTH
TGEKPYECKQCGKAFRESHFLKSHERTHTGEKPYKCKQCTKAYRYCSSLYKHKMNHTGET
IRM
Download sequence
Identical sequences XP_015453976.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]