SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015456046.1.64745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015456046.1.64745
Domain Number 1 Region: 64-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 272-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 475-512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 231-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 436-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015456046.1.64745
Sequence length 735
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X2 [Pteropus alecto]; AA=GCF_000325575.1; RF=representative genome; TAX=9402; STAX=9402; NAME=Pteropus alecto; AL=Scaffold; RT=Major
Sequence
MRGREPALSSDCVVLCPHKGCCWPQAGAGVTRATALHWTFFVFPTVNIVLSGRLSSAVPA
LAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQC
SLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRG
KLGQASCQSDEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPC
SGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGNFYGSFASPDLFGAARGPSD
LHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAA
QGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDMSDVGEQGCFSEPQRCD
GWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTSADRCNNQKSCPDGADEKNCFSCQPGT
FHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCA
FKLYSLRSQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQPLPH
PPGLCATEPSNGHAATDAPARLPPRALPPPPRPPLEPALSPASGSTGTDPTADCYPHLTD
SAGRWAPPACTRGRSRPPGTPYRHRQLWGSWRCAPQCSWPCARGGALCAAPLRPAGPGVQ
ACGQGQKGLQGPSGG
Download sequence
Identical sequences XP_015456046.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]