SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015458637.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015458637.1.101067
Domain Number 1 Region: 214-340
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.49e-55
Family A middle domain of Talin 1 0.00000238
Further Details:      
 
Domain Number 2 Region: 1301-1490
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.57e-51
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 440-575
Classification Level Classification E-value
Superfamily I/LWEQ domain 1e-49
Family I/LWEQ domain 0.00000293
Further Details:      
 
Domain Number 4 Region: 346-469
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-49
Family I/LWEQ domain 0.00000478
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-21
Family Second domain of FERM 0.00000802
Further Details:      
 
Domain Number 6 Region: 742-826
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000161
Family I/LWEQ domain 0.0099
Further Details:      
 
Domain Number 7 Region: 1067-1181
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000173
Family VBS domain 0.011
Further Details:      
 
Domain Number 8 Region: 10-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000103
Family Ubiquitin-related 0.07
Further Details:      
 
Domain Number 9 Region: 863-931
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000298
Family VBS domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015458637.1.101067
Sequence length 1547
Comment PREDICTED: talin-2-like [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MLCDVSQDVLEYRRKQRPQKVKMLDGAVKTVMVDDSKTVGELLLTICSRIGITNYDEYSV
VRETGEERRDEGMSTLRKDRTLLRDERKMEKLKAKLHTDDELNWLDHGRTFREQGVEESE
TLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGP
HIEQKHRAGLLDLKEFLPKEYVKQRGAEKKIFQASKVWIQNKVDESKHEIHSQVGAITAG
TASVVNLTAGGPEETDYTAVGCAITTISSNLSEMSKGVKLLAALVEDEVGSGQDLMRAAR
TLTGAVSDLLNAVEPTSGEPRQTVLNAAGSIGQASGDLLRQIGEKETDERFQDVLMNLAK
AVANAAAMMVLKAKNVAQVSEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQ
EQLMEAGKLVDRSVQGCVNACLSATDDGELLKAVSAAAGVVTQALADLLAHVCNYDSCGE
PIGRYNQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVGAMRSDAEAEIDVDNS
KKLLAAAKLLADATARMVEAAKGAAAFPENEDQQQKLREAAEGLRVATSAAAQNAIKKKL
ITRLEVRVFLYRSVTDSINQLITMCTQHSPGQRECDNTLRELEAVIVLLDNPNEPVNGLS
YFDCIESVMENSKVLGESMAGISQNCKTGDVPAFGECVGVASKALCGLTEVARQTSYLVG
VSDPNSQAGQQGLVDPIQFARANQAIQMACQNLADPGSSPSQVLSAATIVAKHTSALCNA
CRLASAKTTNPVAKRHFVQSAKEVANSTAILVKTIKALDGDFSAENRDKCRVATAPLIEA
VDSLTVFVSSPEFGSVPAQISREGSAAQEPILQSARSMLDSSIKLLTTARSLVLNPKDPA
LWSLLAAHSHTVSDSIKSLITAVRDKAPGQRECDSAIDSVRKCIREMEHACLSAVSQNLP
TRQDISLEALQEQLMSSVQEVGHLIDPISTAAKGEASQLGHTVSQLASYFEPLSRAAVGV
ASKMMHHQEQMNLLDQSRTLAESALQMLYAAKEGGGNPKVASSGRENILKTAKALVEDTK
NLVSGAASSPEKLARAAQSSAKTITQLTEVVKLGAASIGPDDPETQVVLINAVKDVAKAL
AELISATKGAAGKAAEDPSMLQLKGAAKVSLVLSALQAGNKGTQACITAASAVSGIIADL
DTTIMFASAGTLNTENDSDSFAEHRAAYGDGVSEEVRSRALQYGTECTNGFLELLDHVLQ
VLQRPTVEQKQQLAWFSKRVAGAVTELIQTAESMKDERTEWVDPEDPTVIAETELLGAAA
SIEAAAKKLEQLKPRAKPKEADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQG
KVGSIPANAEDDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAAS
TAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVKAAQKAAFDKADDENVVVKTKFV
GGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRGDED
Download sequence
Identical sequences XP_015458637.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]