SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015465589.1.19336 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015465589.1.19336
Domain Number 1 Region: 142-256
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000805
Family UAS domain 0.054
Further Details:      
 
Domain Number 2 Region: 353-437
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000336
Family UBX domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015465589.1.19336
Sequence length 466
Comment hypothetical protein AC631_04737 [Debaryomyces fabryi]; AA=GCF_001447935.1; RF=representative genome; TAX=58627; STAX=58627; NAME=Debaryomyces fabryi; strain=CBS 789; AL=Contig; RT=Major
Sequence
MSRLSSSWIRHLLGQETYQPLGNSVDSSQANNEPLPGHYPEEPVLQSNRNAINSNSIQHL
FKNVGNWISFLLIKPIIIMLILSFRILAKIINIIYFRDQYTRSNSRNTANLAINKTGLND
SIDKVNKFIRDLEDNLTPVQHQNLESGLSPQLPPFFLGSYTQALYMATNRAKFLFVYLSN
PQNENSSTIFNKVITNPDFISLFNSNPNILIWGGDLTNPEAYQLANSLNVTKFPFLGLLC
LTRTTTMSQQGPVKTSPKISLILKIQGGLDEDVNIRTTVIDKFKRKIRKFDEELIVMRTE
LRDKYMSQVLLRQQDINYQNSLKNDQLKKQEKLYKQLKNEYLNWKSVYFNKLKEENDHED
SAKIAIKLSDGERVTFHFPSQNLIDDIFIFVELQNGNYLDGSIKSTITDDEASERFKDFK
LNYKFKLVSPLPPRTVLNNYLDEENHPIIRDINYIYPNGLLIVEDV
Download sequence
Identical sequences A0A0V1PU16
XP_015465589.1.19336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]