SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015496270.1.82291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015496270.1.82291
Domain Number 1 Region: 42-557
Classification Level Classification E-value
Superfamily Sema domain 7.46e-99
Family Sema domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1428-1553,1719-1875
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.57e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 991-1081
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000104
Family Other IPT/TIG domains 0.066
Further Details:      
 
Domain Number 4 Region: 901-989
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000598
Family Other IPT/TIG domains 0.0096
Further Details:      
 
Domain Number 5 Region: 560-612
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000183
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1080-1164
Classification Level Classification E-value
Superfamily E set domains 0.000000000878
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015496270.1.82291
Sequence length 1943
Comment PREDICTED: plexin-D1 isoform X2 [Parus major]; AA=GCF_001522545.2; RF=representative genome; TAX=9157; STAX=9157; NAME=Parus major; AL=Chromosome; RT=Major
Sequence
MAPAPVPATGAEPRPPALLPPPPLLLLLLLLLPGRAAGLEVQRKFLSPTLTNNFALDGPG
SRVYLAAVNRLFQLSGGELALEAEAAVGPVLDSPLCHAPQLPQASCEHPRVLTNNYNKIL
QPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPGGSDSVTVFPSMLNVAANHPNAS
TVGLVLRRGGGGGARLLVAATYTGFGSPFFPRNGSLEDHRFENTPEIAIRALNARGDLAK
LFTFDINPSDDNILKIKQGDKARHKLSFVRAFLQHGAAPPARRPYAYLALNSEANAGDKE
SPAHSLLARICLGEPAEATLNGSGETKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAW
RSPGAPHGPGLAPPPPEELLFGVFERAGAGGGRGRSQSALCVFRFAEIEETIRAARNSCF
VSPAAGMVTVLDSVVQGTGPACEKRNIQLQPEQLDCGAAHLQHPLAIVNPVTATPIFTYS
GLTAVAVASVNNYTVVFLGTASGGLLKINLDSTMKVISRRSISVAYGEPVHPIMQFDPSD
STYLYLMTSYQMTRVKVAACSQYSTCTECLAAADAYCGWCTMETRCSLQHECTNFTGANF
WASVSEGVQQCPSMTILEPEINIDKENPALIIQINGTIPNLNGTNISCDYGNNIHTVARV
AGDYVNQFIYCSLLPHEKYPAFPDDQDHVVVETSLRVNNKNIIRANFTIYDCKRIGNIYP
KRACTSCLSARWKCHWCPSAYSCVSNHSQCEDVLQMEKKIDCPRIVPALLEPMPTGVSRN
IMISLVNATFSKETALECHFGTDRTFEARWVNSSAVECVHVLLHTSEKSHHFPVNLQLKD
KPDRFIDSPEMMTVEVYNCATGSADCSQCLGREDLGHRCLWSESSSSCRLQTEPPQLSDV
CPPPEIRKIEPLRGPLEGGTLLTIRGRNLGRRFSDILGAVRVGGVRCSPLPGRYVVSETV
VCQTGEAQEAFSDVVTVNVSREGRSRERFSYVLPMVQSITPANGPKAGGTRVTIRGSRLD
VGSELRVLINSSKQCTDLSRTDSTITCTMPAAELTTAVPVCVQFENKSCASHNITFKYEK
NPVISDINPKKSQISGGRIITLEGRGFGLVQNVSMAVRGIGREHTRCKVHTDTAITCPSP
AASNVTAGSKPAPVDFFLNGRLYTDERSALDEEMYPEEALHISKFSLGYYSDPQFSTAKK
EKWIKHHPGEPLTLVIHKEPDSLGLESNEYQVKIGLISCEIQIVSDKVIHCSINESLSSS
ERQLPVTIQVGKFNYTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERY
WQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYRHFVTRTFFPKC
SSLYEECYILPSQQLSSQAGAQVQETHPLLVGEWKIPENCRPNMEEGISLFSTLLNNKHF
LIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLM
LRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKARYTLN
EEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPR
VEDVDLEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDTTL
SRVKDLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLF
KAILSIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFV
FDIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQI
HDMPPLSEQEMNAHLAEESRKHRNEFNTNVAMAEIYKYAKRYRSQIVAALDANPTTKRTQ
LQHKFEQVIALMEDNIYESCSEA
Download sequence
Identical sequences XP_015496270.1.82291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]