SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015507749.1.82291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015507749.1.82291
Domain Number 1 Region: 536-755
Classification Level Classification E-value
Superfamily Bet v1-like 2.9e-39
Family STAR domain 0.0062
Further Details:      
 
Domain Number 2 Region: 139-255
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-25
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015507749.1.82291
Sequence length 764
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X1 [Parus major]; AA=GCF_001522545.2; RF=representative genome; TAX=9157; STAX=9157; NAME=Parus major; AL=Chromosome; RT=Major
Sequence
MGNSARIRGRAGQDYNSRGAPRWGGVLVDDGIRPPPHLRWLRRERAERVPSRRTRARPSS
PRCPGVVALAAGGVCGDAARGARGCEPGCRPVAGRGGRRSVAAPARVEPGAPVPSAEEGC
CGRGPLRLFHSSAVAAAPVSMSDNQSWNSSGSEEDPETELGLPVELCGVLSKWTNYIHGW
QDRWVVLKSNTLSYYKSEDETEYGCRGSICLSKAEITPHDFDECRFDISVNDSVWYLRAQ
DPDHRQQWVDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREK
LAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTVRPDGDFVHNS
NSNKEKLFPHETPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRLDKE
TEKRRRIEEAYKNAVTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKMEEQS
QSEKVRLHWPTSLPSGDAYSAVGTHRFVQTPYSRSSSMSSIDLVSASDDVHRFSAQVEEM
VQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCH
YFWNVDVRNDWETTIENFHVVENLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPAFSE
NDPETWIVCNFSVEHDSAPLNNRCVRAKINIAMICQTLVSPPEGNKEISRDNILCKITYV
ANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_015507749.1.82291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]