SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015512363.1.5119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015512363.1.5119
Domain Number 1 Region: 534-698
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.94e-70
Family A middle domain of Talin 1 0.00000984
Further Details:      
 
Domain Number 2 Region: 2341-2531
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.62e-53
Family I/LWEQ domain 0.00015
Further Details:      
 
Domain Number 3 Region: 705-828
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.1e-52
Family I/LWEQ domain 0.0000265
Further Details:      
 
Domain Number 4 Region: 798-935
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-45
Family I/LWEQ domain 0.0000499
Further Details:      
 
Domain Number 5 Region: 1893-2018
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.49e-34
Family VBS domain 0.00012
Further Details:      
 
Domain Number 6 Region: 1270-1404
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.11e-32
Family VBS domain 0.063
Further Details:      
 
Domain Number 7 Region: 230-344
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-31
Family Second domain of FERM 0.0000124
Further Details:      
 
Domain Number 8 Region: 345-435
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-25
Family Third domain of FERM 0.0000359
Further Details:      
 
Domain Number 9 Region: 1122-1253
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.87e-16
Family VBS domain 0.054
Further Details:      
 
Domain Number 10 Region: 1514-1598
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000392
Family I/LWEQ domain 0.0063
Further Details:      
 
Domain Number 11 Region: 2055-2178
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000113
Family VBS domain 0.02
Further Details:      
 
Domain Number 12 Region: 1634-1703
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000033
Family VBS domain 0.035
Further Details:      
 
Domain Number 13 Region: 108-167
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000035
Family First domain of FERM 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015512363.1.5119
Sequence length 2658
Comment PREDICTED: talin-1 isoform X1 [Neodiprion lecontei]; AA=GCF_001263575.1; RF=representative genome; TAX=441921; STAX=441921; NAME=Neodiprion lecontei; AL=Scaffold; RT=Major
Sequence
MSARIEQSVDSGGFCERRRSPSAVAMATLSLRISIPEQNATKMMQFDPTTSVYDACRVIR
EKLTDSASLGQPKDYSLFLADEDIKKGVWLEPGRNLDYYILRNGDLLEYRRKLRTLRVRM
LDGTLKTLLVDDSQPVANLMVVICTKIGLTNHDEYSLVRELPDEETENQKPGNFGTLTLK
RRKEEKGERDAKMDQLRKKLKTDDEVNWIDPSQTLREQGIDEQETVLLRRKFFFSDQNID
SRDPVQLSLLYVQARDAILDGTHPITQEKACTFAGIQCQIQFGDYKEDKHKTGFLDLKEF
LPQSYLKVKGIEKKVFAEHKKHAGLSELDAKVLYTKTARSLSTYGVTFFLVKEKMKGKNK
LVPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWGASPNTFTLDFGDYSDQYYSVQTTE
AEQILQLIAGYIDIILKKQKAKDHFGIEGDEGSTMVEDNVLPLKGTIMQHETSNKGKGNI
ESVALPVVIRVGGDGAQSYGTGHMGAAQYSTVSGQAIPGHAPSMVQQTKVTSVLSEPQRA
LLSTITASHQVIQTAESELSSKAQLPELGTDPASLKWIEQTMDTHKQSVGSQIAAMNAAT
AQVVTLTSGPADDVDHTAVGAAITTIASNLPEMTKGVRMIAALMEDDSSGDRLLDAARKL
CVAFSDLLKATEPETKEPRQNLLNAASRVGEASHQVLTTIGEEDESNRELQDMLLALAKA
VANTTAALVLKAKNIAATCEDSTTQNRVISAATQCALATSQLVACAKVVAPTLHSPACQA
QLMNAVREVTKAVEGLVEVCNETCNDEVLLRELSTAAGEVSRTLNDLLNRIQSATRGEKA
KESVQEGAVETIFVATDKLFASTGDAGEMVRQAKVVGQATAQLIHSIKGEAENQPDGDQQ
RRLLAAAKILADATAKMVEAARQCASSPHDARMQDQLRQAAEELRAATTAAATPALRRKL
ITRLESCAKLAAANATQCISAASGAGKHNTNAASQEELIAECRAMAQQVPNLVTGVKGTL
AQPDNSSAQLDLINAAEQFLQPGSSVVKAARAVVPTVSDQASAMQLNTSSQQLGSTLSDL
RSAVTRAREACGGLELDAAEELINSLKDELSEFYQAVEAARLRPLPGETAESTALQLGAS
SKNVGVAMAQLLSAAKQGNENYTGSAARETASALKELTNAVRGVAATSNQPETQKKVLIT
ADDIILRSLHLVKEARRALNNPDNPDNVGNLAAVAKDVSQSLNKCVSCLPGQRDVDDAIR
SIDDMSQVLNMNEFPQTNKSYGQLQQNLNTAAADLNDASSNVVSSIRSPVQLANTSKEFT
NAFGELLGVSMEMAGQTTTETRGKMVVSLKNVSMTSSKLLVTAKSVAADPGAPNAKNQLA
AAARAVTDSINYLVDVCTSAAPGQNECDSAIRNIQSMRPLLDNPSDPISDVSYFECLDTV
MEKSKSLGEGMTGIANHAKKSEHEQFSVAVRGVSSSICGLVEAAAQAAYLAGVSDPTSVA
GKPGLVDQAQFFRAAQAIHTGCQSLANPTSSSQQVLHAATMIAKHTSALCNACRVASSKT
SNPVAKRHFVQSAKDVANSTGSLVKEIKALDQVCSEANREKCSEATKPLLEAVDSLCSFA
SSPEFASQPAKISVAARAAQEPITSAGKSIIDGSCAMVQAAKSLAVSPKDPPTWQLLANH
SKNVSDSIKSLVASIRDKAPGQKECDGAIETLSARIRELDAASLSAVSQALVPRKENTMQ
GFTDQMESSANELREKLEPLRSAAKYGAEHVGHAVSQIALYSEPLVTGAVGAASNMVHSK
QQMVLLDQTKTVAESTLQLIYVVKESGGNPKAVNIHSEVDENVESTKDALRELQNTLETI
STSNGIVTGLIDTISRAMVRLEDHRMSTVDTVDSYVDYQTRMVEAAKEIARLAQEMSTKS
SVDVSRLGPLAVDISHKYTQLSRDASGASAATTNADVSTRLRIGVQELGQACADIVKAAG
TCQMASGDAFTQREVSEQSKNVSEKVSQVLAALQAGSRGTQACINAASTVSGIIGDLDTT
IMFATAGTLHAENEGDIFADHRENILKTAKALVEDTKTLVAGAASSQEQLAVAAQNAVST
IVQLAEVVKYGAASLGSHNPEAQVMLINAVKDVASALGDLIQATKTASGKPINDPSMAHL
KDSAKVMVTNVTSLLKTVKAVEDEHTRGTRALESTIEAIGQEIRSLNTTEVQLKSTVTPE
DLVRCTKNITISTAKAVAAGNSCKQDDIIAAANMGRKSISDMLLICKNAAHNCAETAELR
DRTLNAGHDVAMNYRELLQAILQISTRPSDAKHVLPPISRKIAQSVTELVTVAELLKGND
WVDPDDPTVIAENELLGAAASIDAAAKKLASLRPRRSIQEASEDMNFDEMILEAAKSIAA
ATSALIKAASAAQRELIATGKVSRTPLTSSDDGQWSEGLISAARLVAAATHSLVESANAL
VQGVSSEEKLISSAKQVASSTAQLLVACKVKADPDSESTKRLQAAGNAVKRATDNLVRAA
QQAIQQEEDRSLVLNRKMVGGIAQEINARSEVLRIERELEEARGRLTAIRQAKYKSKTDT
SDDAETDADQSGYESYTTRYETRSYEPNQSRSPIQMMNSTLDQLQPATEYISHKKLTESS
TSVHVKKTFTHQVLRFDN
Download sequence
Identical sequences XP_015512363.1.5119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]