SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015519510.1.5119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015519510.1.5119
Domain Number 1 Region: 576-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.66e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000129
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 318-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000202
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 493-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000158
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 630-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000498
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 547-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000182
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 434-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000329
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015519510.1.5119
Sequence length 1101
Comment PREDICTED: zinc finger protein 729-like [Neodiprion lecontei]; AA=GCF_001263575.1; RF=representative genome; TAX=441921; STAX=441921; NAME=Neodiprion lecontei; AL=Scaffold; RT=Major
Sequence
MDVAGDLTLQWVEEVGNVVHEEVICDLEGELDTPEEEVIGACEEVSVEDTVETVPEACPA
PDSEILLVPQSNDMESIYIVPQDGQGHDYLNIQVTEEVISDNWDRPGQHDGVEIPETKVS
HDNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLC
GARYVRKCDLMNHLKIHAYAPSRDGLEDDLNDDDSLIPEEEETNKGRRKKVQSNAPRKRK
NNAAAAKRAAPEIKVEMGKYVNKSYDYVDEDMRLLEEMTNRNSARGNNYASSSRWNEQLT
SEHIEPQPPRWPITDPTKPYVCQHCGVGFAREKALASHSRVHGGDSPFECTSCGDMFWDV
NTLREHVRIKHGGAVQSDLEEYDNDATYTGDERFGEFYCDTCGVPFHRLDLLKRHRKIHV
KQETTEVITKGSSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGQRCRDDAEVA
EHVRQNHAEDAPPNTCTLCGKTCKDKRSLIKHSWVHNADKTFGCTKCGKHFHNKARLRRH
MVSHRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIR
IHTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHS
GPDPKCHGSMTPYLCKVCGDSYGTSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLK
PYETNPVPPRMAAVSYETPDIASDSDDNTKRKLGKKNKQQHRANVEEGYQNVLKSFESSL
QNISSIVSNSKANPAKSKLSKRKAKKDEKKNETQTSAQSSRPKMIHTQKTRVPVQIGGDG
VKKGQKTKTMVTRTPKVMPNEHKTGVFPSGERNRPRTKNVSYHIEGKLQLTPATFPTKPN
EELEKPHSVTFLEKNIKIEPGSQKNSGAVHSNNNGNIAIAERKVEPTPRKKPAVVKKVRK
QKQVVIKQEPKDDESSQEATQNNNNAIEMNQTSHMLDNALDGNNLEVAYEASIVTAEEES
ILPDLDTHTIHNEVAEKESFQLSVKMLESAPHRMLAVHHVITPVDEVPETIIPDAVEYTC
EMCSAVFSSRAELLVHVPIHI
Download sequence
Identical sequences XP_015519509.1.5119 XP_015519510.1.5119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]