SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015599107.1.68462 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015599107.1.68462
Domain Number 1 Region: 573-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.33e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000112
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 317-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000023
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 490-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000169
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 622-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000146
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 544-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000185
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 431-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000318
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015599107.1.68462
Sequence length 1097
Comment PREDICTED: zinc finger protein 16-like [Cephus cinctus]; AA=GCF_000341935.1; RF=representative genome; TAX=211228; STAX=211228; NAME=Cephus cinctus; AL=Scaffold; RT=Major
Sequence
MDVGGDLALQWVEEVGNVIHEEVICGLEAELTAPEEEVIGACEEVCVEETVESGPDCGTT
ADSEILMVPQTSDMESIYIVPQDQGHDYLNIEVTEEVIADNWDRSGPDDGVEIPETKVSH
DNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLCG
ARYVRKCDLMNHLKIHAYAPSRDGLEDDLNDDDSLAHDEEEPNRGRRKKAQSSAPRKRKN
NAASAKRNNDDIKIEMNKYMNKSYDYVDEDMRLLEEMTSRNTARSSNYASSSRWTDEIST
MPSEPQPPRWPITDPTKPYVCQHCGVGFAREKALASHARIHGGDSPFECTSCGDMFWDVN
TLRDHVRMKHGGTVHTEMDEYDNDATYTGDERFGEFYCETCGVPFHRLDLLKRHRKIHVK
QEIDMTEGSSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGQRCRDDAEVAEHV
RQYHADDAPPNTCNLCGKTCKDKRSLLKHSWIHNADKTFGCTKCGKRFHSKARLRRHMVS
HRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRIHT
GERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPD
PKCHGSMTPYLCKVCGDAYSTSEEIVAHIVQHCDDNTALRRQPQSGPRKYKRRRKLKPLE
GASMNMPRMSENYVDMLQQPGSDSDDNTKRKLGRKNKQQHRANVEEGYQNVLKSFESSLQ
NINSIVSNSKLNPSKSKLSKRKIKKEDKKNETQTSSQSGRPKMIHTQKTRVPVEVGSDGA
KKGQKTKTMVTRTPKVMPSEHKMGIFPGGERNRPRTKNVSYHIEGKLHVTPATFPKPKED
MDKPLSPLLTNIKIEPGLQKSSSNNHSNNNGNILGMNIEKAPTPSRKKPVVMRRVRKQKQ
VVIKQEPRDIDDEEEDEMQNNNISQRVEPVRLSANRLDRTNMDLNFEANLLNAEHESILP
DIGRSDHMDDMENGNVKLSVKMVESTPQRLMTIHSVIGPVDDVPETIIPDAVEYTCEMCS
AVFSTRAELLVHVPIHI
Download sequence
Identical sequences XP_015599107.1.68462 XP_015599108.1.68462 XP_015599109.1.68462 XP_015599110.1.68462 XP_015599111.1.68462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]