SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015599760.1.68462 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015599760.1.68462
Domain Number 1 Region: 92-547
Classification Level Classification E-value
Superfamily Sema domain 9.29e-124
Family Sema domain 0.0000558
Further Details:      
 
Domain Number 2 Region: 1432-1556,1790-1974
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.68e-42
Family p120GAP domain-like 0.031
Further Details:      
 
Domain Number 3 Region: 899-989
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000294
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 4 Region: 1078-1148
Classification Level Classification E-value
Superfamily E set domains 0.00000000000182
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Domain Number 5 Region: 549-601
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000837
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 992-1078
Classification Level Classification E-value
Superfamily E set domains 0.00000000187
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015599760.1.68462
Sequence length 2010
Comment PREDICTED: plexin-B [Cephus cinctus]; AA=GCF_000341935.1; RF=representative genome; TAX=211228; STAX=211228; NAME=Cephus cinctus; AL=Scaffold; RT=Major
Sequence
MRLLGLKPFPVSPPVPPPPRLPLPSVRLASFSSASIVAWLLVTLVTAAMDAPASSIPPSS
ENQSPHVVAQFPLPVGQRYELYPLDPNTTREGALRFNHLTIDPSTGRLYAGAVNRLVQLD
SNLRLEELVSTGPRMDNPQCHATGCPSRDMTTSLMDNVNKLLVADLESRTLIACGSLLQG
ACEKYKMANISLKPDFIPTSVAANDENSSTYAYIGPERYNPWGKTNILYVGTTFTNNGEY
RHDVPAISSRNLYTLEFAEYTFNKQSILHIDVKYRDHFLVKYVYGFNASDYAYFVLVQKQ
SYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCSVDLGDGRQHLYNLVQDAKVAAAGA
DLAMQLGIAVGDPVFVSVFSPSKGITNEPLPRSAVCVYSLQDIETKFNENIHMCFNGSIK
YRNMGYVSGPILDGKCPTAGTTGNILDFCEVGLKISGVSPIIGQAVLHFANAYVTSITVT
NTESHTVAFLGTHDGVLKKVLLSGIEASIYESIVIDKGQKLLPDTAIAPGGEHIYVLSTS
KISKVKVEHCSGYTNCSSCLDAKDPYCGWCSLEKRCTVRRACQKASHSSPRWLSLGTGQQ
CIDFEQVLPDRIPINQMTTVQLSIRTLPELPTGAKYKCVFGKAEPIDAQMTGYGLSCPTP
PVFGRPSIPEDADHVLVPLSVRSSETNKDFVSRNFAYFDCSRHTVCADCVKSQWACSWCV
YENKCTHNTSGCQGNIISGENNQANLAAHGVQYCPRFVERKEPLMLPNNVPKEIVLEVEN
LPHPQVGHTGFQCIVTIEGANLRVQARVDSSRFIVCDKTIYSYEAVTGEYSAAVTVVWNT
NHHVDQTTIVLYKCEVLGSHREHADCSLCVTRDPRFECTWCGNSCVYRHSCLQSPFAECP
KPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLVDYEVSVRIVCRT
GRHEATDRASVVVGNDAGYTESAVFFNYKDIQLSGVYPAMGPQSGGTQLAISGMYLNIGS
TISAYLDELPCHVNATQASSTRLTCITSKAGQVRRTRRLTLSIDGANRTLVGNPYNYTHD
PTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNELLPVNKTICSVLNPTQMEC
PSPSVAERFRSLQRTKRSLHKHGSQALKIKEHQLALRIGFVMDHVESVRDLEKHFQSLRN
QLLYVEDPKFFAFPGNVKLYKGDPLVIEGDNLNYASDESDVNVTVGIMPCNITSLALTQL
VCTPPDQQPADTDELGVKTEQGLPLVVVRVGQSLRFRIGYLHYDVIKSYPIPPEAIAGIA
AGTFGLVFLFVLVLVVYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDMTDL
TADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRVRSNTSRTNYDAAMIQFEQLINNK
CFILTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKSVDTKHP
QLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHDARY
SLSEERLLREQIEHSVVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPFSLR
PSIHEVDLEWRHGRGGHLTLQDEDLTTKCNSDWKKINTLAHYGVKESAVMSLIPRQNDGF
SVTCKPPCHNCKPSHHHHANHCSSAHLPSTPNHAMISPIMYSHPPSGIYFNSQNSPPIIT
ANGDIESGHGGNQRLYHLVRPIEEGHYPPGIGLAGGKHPHPERTHKAIPEIFLTRLLSTK
GTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEAAKRHGIIDPEVPHAWKSNSLPLRFW
VNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSTTEHRLGKDSPSNKLLFAKDIPHYR
EKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANEFDVIAALKELYIYVSKYYEQILEAL
ETDAGCRKLHLAHRLENVACTLEGEETSAC
Download sequence
Identical sequences XP_015599759.1.68462 XP_015599760.1.68462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]