SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015612244.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015612244.1.37577
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.38e-22
Family BAR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015612244.1.37577
Sequence length 627
Comment PREDICTED: uncharacterized protein At2g33490 isoform X1 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MKSSLRKLRGFALQRHEQRVDRRGGHSPAAAAAANELLAASQDMADMRSCYDNLLSVAAA
IANSAYEFSEALQEMGTCLLKRVTPNKDGINDKVLLLLGKAQFELRKLVDSYRVHVLNTI
TTPSQSLLNELQTVEEMKHQCDEKRELFEFLLNAQKEKGRSKNAKSDIGASEQLKQAQDD
YQEEATLFLFRLKSLKQGQFRSLFTQAARHHAAQLNLFRKGLKSLEAVEPHVRLAAEQQH
IDHQFSALDEEDYSVDEENEDDYNDSHEDLSFDYGENKEGTEAGHASRSPTEELLDRSKA
EYSSFPGERQRSGSQSAPLFPEKKLEAAERIKELRRSATRKLYTYVLPTPNDVRDTSQTV
TANPTSGSPLGNKGAFYSSPLQPSTNVGDLRDNKLPSPTRLSNAHSVLKESNTNTTDTRT
MLVLPLGDLSLPGYHDSKASDNKKVKRGSFSGPIVPRSRSTENIDVVSVPPRHSSSHQPS
IHVRVSPNTSPPLLSSPKIKELHELPRPPANASKHTTFPSLVAHSAPLVPNSAPLAPRGQ
DHFRPRQTPPSAPQTASPLPTPPGPISRSFSIPSRGMRTSGISDGKETEDLQDKGPARMS
LSSLPSAQTSLEDHRPLSGATESVSKT
Download sequence
Identical sequences A0A0E0QTK0 Q0J0H3
XP_015612244.1.37577 39947.LOC_Os09g33510.2 LOC_Os09g33510.1|13109.m03331|protein LOC_Os09g33510.2|13109.m07549|protein LOC_Os09g33510.1|PACid:21925480 LOC_Os09g33510.2|PACid:21925481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]