SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015620548.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015620548.1.37577
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily PX domain 9.16e-34
Family PX domain 0.00039
Further Details:      
 
Domain Number 2 Region: 183-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000101
Family BAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015620548.1.37577
Sequence length 399
Comment PREDICTED: sorting nexin 1 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MSQERSQSQSPRSPASAAGVPFLSISVTDPVKMGTGVQAYISYRVITKTNLPDFEGQEKI
VIRRYSDFEWLHDRLAEKYKGIFIPPLPEKNAVEKFRFSKEFIELRRQALDLFVNRIASH
PELKQSGDLKIFLQADEEKMDRERSYETGIFKKPSDFLQMFKDVQSKVSDVVLGKEKPVE
ESSPEYEKLKNYIFELENHLAEAQKQAFRLVKRHRELGQSLADFGKAIKLLGACEGDSLE
KVFSEVGSKSEMLSVKLQREADNLLFNFEEPLKDYVRAVQSIKATMVDRANAFRQHHDLF
QQKEYKGVNLEKLKFVNPDKFSELEAEVRELTADSEEATKRFEHIVAVMNEELARFQEQK
TADIGFAFHEFAKGQAKLAKDIADAWRGVLPKLEACSTS
Download sequence
Identical sequences I1NTK9 Q5N7G9
LOC_Os01g64280.1|13101.m06919|protein LOC_Os01g64280.1|PACid:21909473 ORGLA01G0319900.1 XP_015620548.1.37577 39947.LOC_Os01g64280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]