SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015620678.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015620678.1.37577
Domain Number 1 Region: 376-747
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-116
Family Oxysterol-binding protein 0.00049
Further Details:      
 
Domain Number 2 Region: 56-86,122-180
Classification Level Classification E-value
Superfamily PH domain-like 3.68e-20
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015620678.1.37577
Sequence length 756
Comment PREDICTED: oxysterol-binding protein-related protein 1D isoform X1 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MNPLCCIAPVSLDSAVEHHHQPPRILAAAAAAPTSPTPPAAAVAAQVVLDAAQAAVAGVL
HKWVNYGKGWRLRWFVLEGGVLSYYKLRVGGGGDSAASPAVAARVIGEGGALRRAREEAA
AAGKQWKPFGEIHLKVSSIRASKSDDKRLYIFSGTKTLHLRCETEEDRNAWIQALQAAKD
RFPRSLTSNDFSPMSDVLLSTEKLRVRLLQEGLNETVVKECESIMMTELLELHNQMKSQQ
QQYSILIDRLRQLETEKVELERTVVHETKEREAHGYANGRYSDFYSVLSGGSASESDPDT
ASQVADVETDEDEVMYFDTRDFLSAESLRSASCRRRELLTNGCNGLEHTDPAANVVKTTQ
YPSVKRRDKLPEPKEKENPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQKCFEDLEYS
YLVDHALQWGKQGDSLMRTLHVAAFAVSGYASTEGRQCKPFNPLLGETYEADYPDKGLRF
FSEKVSHHPMVVACHCEGRGWKFWGDSNLKGKFWGRSIQLDPIGVLTLQFDDGETFQWSK
VTTSIYNIIIGKIYCDHYGTMRIKGSGDYSCKLKFKEQSIIDRNPHQVHGFVQDNRTGQK
VAMLIGKWDEAMYYVLGDPSAKPKGYDPMSEAVLLWERDKSLNQTRYNLSPFAISLNELT
ANLAKKLPPTDSRLRPDQRHLENGEYEMANAEKLRLEQLQRQARRLQEKGWQPRWFSKDD
DDSYRYIGGYWEAREKGNWDGIPDIFGQRSASPGWS
Download sequence
Identical sequences Q2QTR4
39947.LOC_Os12g18770.1 XP_015620678.1.37577 LOC_Os12g18770.1|PACid:21935711 LOC_Os12g18770.1|13112.m02001|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]