SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015625785.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_015625785.1.37577
Domain Number - Region: 38-74,407-602
Classification Level Classification E-value
Superfamily TPR-like 0.000488
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 
Domain Number - Region: 648-730
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.04
Family Calponin-homology domain, CH-domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015625785.1.37577
Sequence length 751
Comment PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MTHAAHALCNRYAAILSSAAGDGGRTGVRVAGAVHCLILKTFLQAPPTFLLNHLLTAYAK
SGRLARARRVFDEMPDPNLFTRNALLSALAHSRLVPDMERLFASMPERDAVSYNALITGF
SSTGSPARSVQLYRALLREESVRPTRITLSAMIMVASALSDRALGHSVHCQVLRLGFGAY
AFVGSPLVDMYAKMGLIRDARRVFQEMEAKTVVMYNTLITGLLRCKMIEDAKGLFQLMVD
RDSITWTTMVTGLTQNGLQLEALDVFRRMRAEGVGIDQYTFGSILTACGALAALEEGKQI
HAYITRTWYEDNVFVGSALVDMYSKCRSIRLAEAVFRRMTCRNIISWTAMIVGYGQNACS
EEAVRAFSEMQMDGIKPDDFTLGSVISSCANLASLEEGAQFHCLALVSGLMRYITVSNAL
VTLYGKCGSIEDAHRLFDEMSFHDQVSWTALVTGYAQFGKAKETIDLFEKMLANGLKPDG
VTFIGVLSACSRAGLVEKGCDYFDSMQKDHGIVPIDDHYTCMIDLYSRSGRFKEAEEFIK
QMPHSPDAFGWATLLSSCRLRGNMEIGKWAAENLLETDPQNPASYVLLCSMHAAKGQWTE
VAHLRRGMRDRQVKKEPGCSWIKYKNKVHIFSADDQSHPFSSRIYEKLEWLNSKMAEEGY
KPDVSSVLHDVADADKVHMISHHSEKLAIAFGLIFVPQEMPIRIVKNLRVCVDCHNATKF
ISKITGRDILVRDAVRFHKFSDGTCSCGDFW
Download sequence
Identical sequences I1NWE2 Q6ETD1
LOC_Os02g01610.1|13102.m00082|protein LOC_Os02g01610.2|13102.m00083|protein XP_015625783.1.37577 XP_015625784.1.37577 XP_015625785.1.37577 XP_015625786.1.37577 XP_015625787.1.37577 LOC_Os02g01610.1|PACid:21924264 LOC_Os02g01610.2|PACid:21924265 ORGLA02G0004800.1 39947.LOC_Os02g01610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]