SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015627137.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015627137.1.37577
Domain Number 1 Region: 16-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.85e-26
Family G proteins 0.0062
Further Details:      
 
Weak hits

Sequence:  XP_015627137.1.37577
Domain Number - Region: 180-321
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0691
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015627137.1.37577
Sequence length 330
Comment PREDICTED: protein AIG1 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MGGSEYDDDWELPSADITVVLCGKLGCGKSATGNSIVGREAFVSEYSHASVTSTCQLAST
ALKDGRTLNVIDTPGLFEMTITSEDAGKEIVKCMSMAKDGIHAVLMVFSATSRFTREDSS
TIETIKEFFGEKIVDHMILVFTYGDLVGENKLKSMLNNAPEYLQKTVELCKNRVVLFDNM
TKDRWLQEKQLENLLDVVDSVNTNNGGKPFSDQMLACIKEAHAREQEVHDAIGYTEEQIS
ELKKEIQRTRDEQLANITNMVEEKLNITVDKLQQQLMEEQNARLEAERLAAEARLRSDEE
IRKLKKRLEKAQQENEEFRKMASQHKCSIL
Download sequence
Identical sequences A0A0D9YTN7 A0A0E0NGE3 I1P1B0 Q6YVY1
XP_015627137.1.37577 XP_015627138.1.37577 LOC_Os02g35130.1|PACid:21920622 LOC_Os02g35130.2|PACid:21920623 39947.LOC_Os02g35130.2 ORGLA02G0176600.1 LOC_Os02g35130.1|13102.m03810|protein LOC_Os02g35130.2|13102.m03811|protein OGLUM02G20870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]