SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015628597.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_015628597.1.37577
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily PH domain-like 0.04
Family VPS36 N-terminal domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015628597.1.37577
Sequence length 232
Comment PREDICTED: chloride conductance regulatory protein ICln [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MAPGLQRFTDIAGDGGPRLDAASGEELLRMDRAASVALGRRAPEPPGTLFVTTRRVIWLS
ETEKGQGYAVDFLAITLHAVSRDLEAYPSPCIYTQIDAEDGSDEEAGGSDFEANGDLQLA
KVSEMRIILSDPGQLDALFDVFCHCAELNPDPNAVRNEENGWSGGENMAEGGWIHGDEDM
IDGNDLEAHMFFTNLIGQNGLHDLGRSVRELQIDDQRFEDAEEEDEIQENGH
Download sequence
Identical sequences Q10P28
LOC_Os03g14520.1|13103.m01698|protein LOC_Os03g14520.1|PACid:21911289 39947.LOC_Os03g14520.1 XP_015628597.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]