SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015628934.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_015628934.1.37577
Domain Number - Region: 354-460
Classification Level Classification E-value
Superfamily PH domain-like 0.000521
Family Pleckstrin-homology domain (PH domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015628934.1.37577
Sequence length 474
Comment PREDICTED: VAN3-binding protein [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MGDHHHHHHPRRGSRHAAAGDLRPPEPPLDPLEFLSRSWSASASALDAPRPPPPAPSPSA
VLGIGPIAEDASSAATAACEVVDDGSAFAAAGSSFSFASAATSQLIMERILAQSEVAPLT
SGRLSHSSGPLTGGGSITDSPPVSPEIDDAKYCRAASTPKPQMYRGGNKTVGRWLKDRKE
KKKEETRAHNAQVHAAVSVAAVAAAVAAVAAATAAASGSGKDDRAARTDMAMASAATLVA
AQCVEAAESMGAEREHLEAVIGSAVNVRTPGDIVTVTAAAATALRGAATLKARALKEVWN
IAAVIPVEKGTMGGGHHHKQNMQKQHRKLESNGSSISDDLSLEEENNFLGICSQELLARG
TELLKRTRKGALHWKVVSVYINRMGLVMLKMKSRHVAGTITKKKKSVVIDVCKDVAAWPG
RHLLEDGEHRRYFGLRTAEHRVIEFECTSQREYEMWTKGVARLLIIASERKRAP
Download sequence
Identical sequences A0A0E0NYK7 Q75GL2
39947.LOC_Os03g43510.1 LOC_Os03g43510.1|PACid:21910990 LOC_Os03g43510.1|13103.m04677|protein XP_015628934.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]