SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015629228.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015629228.1.37577
Domain Number 1 Region: 208-403
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 40-158
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  XP_015629228.1.37577
Domain Number - Region: 549-620
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00523
Family Myosin rod fragments 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015629228.1.37577
Sequence length 860
Comment PREDICTED: rho GTPase-activating protein REN1 isoform X4 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MSASEFRIPYQQVSSSQTAENAGQYKICRCGEGDPNTSETGDSSPTSCPNCQVLKSGHLL
LSSKGIGWTTWKKRWFILTRASLVFFRSDPNAPVRGNEPVVTLGGIDLNNTGSVVVKEDR
KLLTVLFPDSRDGRTFTLKAETTEELNEWKSALENALAQAPAVANAVGQNPIFSTDIAEP
AEAPAEQPDDKSVIGRPAEFALVDADGSPSFLEKALKFIEDYGVKVEGILRQSADVEEVK
RRVQDYEKGKNEFSPEEDAHVIGDCIKYVLREMPSSPVPAPCCTALVGAYRTDKTKRLDA
MSKVIYEVFPEPNQQLLQRILKMMQIVGSHKAVNRMSPSALAACMAPLLLRPLLLGECEI
DSDFSMAGDGSFQLLQAAAAANHAQAIVIIMLEEYDEIFDDLEDGSCSSDAYTDSEDGDV
DKEYSTDNDVDGSYDSGEDNIEEDMEDDTEYSSGGSECDDKVKRNNSGKASNVENTSQME
SNDPSHRKLHESNGSTDQIEKSNVRASSSRAKFMEKSSSRNKSKKTLLGRASARRDLSAD
ETDFCSDDETLIEKLENNKTDLQSKITKEVKENSILQASLGRRKEELHERRLALEKEVEN
LRDQLQKERKLRASLESGLMNLRRGQVSFPSTIDSKTKADLEEVATAEADILNLKQKVSD
LRGQLNNNVQMSSTSLCDSCNKRLLSTDKLFEDEQNTSPSNVGPNSMSDMASATDMADIE
QSRKQTTQHSSSSIDKPTLHKHQKSIASNEQSSTISQRAQRILSSKGGIMKDGQDGSFTS
KWNLAQKQYSNNPLLGRLGSNAYSSTRTEESGAVPFALAKLTNRLNFLKERRAILASEMQ
NLNLARPPGPTAPAPKKDST
Download sequence
Identical sequences Q10Q51
LOC_Os03g11140.1|PACid:21912007 LOC_Os03g11140.2|PACid:21912008 LOC_Os03g11140.3|PACid:21912009 39947.LOC_Os03g11140.1 XP_015629228.1.37577 LOC_Os03g11140.1|13103.m01253|protein LOC_Os03g11140.2|13103.m01254|protein LOC_Os03g11140.3|13103.m01256|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]