SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015630259.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015630259.1.37577
Domain Number 1 Region: 144-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000103
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015630259.1.37577
Sequence length 322
Comment PREDICTED: uncharacterized protein At5g39865-like [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MGCTTSRQARHDLRHCPSPLALPRCQSFPARCAGDAGVHVVRLTSTTLGSLEVDKGAPRA
AEAPPMRRMVPRTPTMTPPNEPEAIDAWALMAGLEEHSPLLVPPFARHSFSFPITAVPPE
LAAASRKVTPLPLVEKKKASPVARPRKAVLYFTSLRGVRATHEDCCLARAILGGYGVRVD
ERDVSMHRGFRDELHGLLGLGRGAALAKCWAPAAAPALPSLFVDGELVGNADELKRLHEA
GELAARLAGCESAAPGEAAGACEACADVRFVLCGACSGSCKVYVDDGDDDDENPLDGGGG
GGFRRCTECNENGIVRCPVCCC
Download sequence
Identical sequences A0A0E0GHG1 A0A0E0NQB9 A2XD09 Q8S7X1
LOC_Os03g07470.1|PACid:21914960 XP_015630259.1.37577 ONIVA03G05130.1 OsIBCD038523 LOC_Os03g07470.1|13103.m00835|protein 39946.BGIOSIBCE009834 39947.LOC_Os03g07470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]