SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015631527.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_015631527.1.37577
Domain Number - Region: 127-245
Classification Level Classification E-value
Superfamily PH domain-like 0.00688
Family GRAM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015631527.1.37577
Sequence length 247
Comment PREDICTED: GEM-like protein 1 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MATSWAAPPPGYPYAQGQGGAQPPHPPQSTAVAVTPVSNGVGNPYVIVTPASASPSTCQS
LRKALERYGRKLEDGTRKAADTTGNIWHHLRTAPNMADAAVARLAQGTKVYAEGGHDRVF
TQAFGVVPGEQLRKAYACYLSTSSGPVIGTLYISTARLAFCSDSPISYHAPAVAVAGAAP
AHPPEAIYKVVLPLNQVKSVNPSASMTNRGERYIQIMTTDNHEFWFMGFVSYDKALKNLY
EALQRRA
Download sequence
Identical sequences Q84R37
LOC_Os03g52670.1|PACid:21917710 XP_015631527.1.37577 39947.LOC_Os03g52670.1 LOC_Os03g52670.1|13103.m05739|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]