SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015632792.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015632792.1.37577
Domain Number 1 Region: 154-653
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.02e-168
Family Calponin-homology domain, CH-domain 0.00000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015632792.1.37577
Sequence length 695
Comment PREDICTED: fimbrin-2 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MGLDGLVVVSDPYLQRRFSQADLRALQAQYAALRDAAPSGRLRLRDLPAALSSAGVGAGK
GGDAEKENSAPAAAQLTEEEWASVLKAVARADERPHQGVGFELFLRVYAEMQLRLKGAAA
GKKAGGGGGGIARSSSSSAAAFLTAATTTLLHTISESEKASYVGHINAYLAEDPFLNTAL
PIDPATDHLFHLTKDGVLLCKLINLAVPGTIDERAINTKKLLNLWEKNENHTLCLNSAKA
IGCTVVNIGTQDLAEGRPHLILGLISQIIKIQLLADVNLKSTPQLVELVEDSKEMEELMS
LSPEKILLRWMNFQLKKGGFQRTVTNFSSDIKDSEAYACLLNVLAPECSAKPSPMSVKDL
LHRARLVLEHADRMGCKRYLTPKDIVDGLPNLNLAFVAHIFQKRNGLSKQMKQVSFVDGL
SDDAQVSREERSFRLWINSLGISTYINNVFEDLRNGWVLLEVIDKIAPGSVNWKMANRPP
IKLPFRKVENCNQVLKIGKELKFSLVNIAGNDIVQGNKKLILAFLWQLMRYNILQLLKNL
RFHSNGKEITDNDILIWANKKVKDSGKHSRMESFKDRSLSSGIFFLNLLGAVEPRVVNWS
LVTKGEKDEEKQMNASYIISVARKLGCSIFLLPEDILEVNQKMMLTLTASIMYWHLKKPT
SFSLDTENGSSCETSSISTSDDSASESSFDDSGAR
Download sequence
Identical sequences A0A0D3EPI9 A0A0D9Y9J9 A0A0E0FM86 A2WQN6 I1R2B6 Q5QMW7
XP_015632792.1.37577 ONIVA01G19560.1 LOC_Os01g33080.1|13101.m03340|protein OGLUM01G20580.1 39946.BGIOSIBCE002080 39947.LOC_Os01g33080.1 OsIBCD001989 ORGLA01G0145000.1 ORGLA11G0190800.1 OBART01G17720.1 LOC_Os01g33080.1|PACid:21905257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]