SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015637135.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015637135.1.37577
Domain Number 1 Region: 218-604
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.74e-95
Family Regulator of chromosome condensation RCC1 0.0009
Further Details:      
 
Domain Number 2 Region: 6-116
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 610-675
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.31e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  XP_015637135.1.37577
Domain Number - Region: 774-816
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0445
Family Mitotic arrest deficient-like 1, Mad1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015637135.1.37577
Sequence length 1057
Comment PREDICTED: uncharacterized protein LOC4337469 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MADPVDIDKALIALKKGTQLLKYGRKGKPKFTPFRLSNDESTLIWVSNNKEKSLKLSSVS
RVLSGQRTLVFQRFLLPEKDHLSFSLIYNDGKRSLDLICKDKVEAEVWFAGLNVLISPGQ
HGSQHQHIDGIRNGALSFECGRDSSLSSSSAYTTDSFENKLSSANSAKDRSSGEFTYSER
TDVSDMQVKGASSDIRISVSSALSTSSHGSGDDSESFGDVYVWGEVMCDTTCRQGSDSNA
YSATAATDILVPKPLESNVMLDVSYVACGVKHAALVTRQAEVFTWGEECSGRLGHGAGTS
IFQPRLVESLSICNVETIACGEFHTCAITATGDLYTWGDGTHNAGLLGHGSNVSHWIPKR
VSGPLEGLQVSAVSCGTWHTALITSSGKLYTFGDGTFGVLGHGNRETISYPKEVESLKGL
RTISVSCGVWHTAAVVEVIMAQSNTSSGKLFTWGDGDKYRLGHGDRSSKLKPTCVPSLID
YNFHKAVCGHTLTIGLTTSGHIFTAGSSVYGQLGNPNNDGRYPRLVEEKLGGGGVVEVAC
GAYHVAVLTQSGEVYTWGKGANGRLGHGDIADRKTPTFVEALRDRSVKRIACGSGFTAAI
CQHKSVSGMEQSQCSSCRQPFGFTRKRHNCYNCGLVHCHSCSSKKALRAALSPNPGKPYR
VCDSCYLKLSKVLDSGIGHNKNNTPRIPGDSKADKMDSKGNRVASANSSDMIKNLDVKAA
KQTKKYDYPPQFPAILQLKDIPFIGAADQQPNDSTYSSPLLRLPNLNSSSSLSSESFDIL
RDANELLKQEVQKLKEEVNSLRQQREQQDADLQKSEAKAHEAMTLASEEASKSKAAKDVI
KSLTAQLKEMAERLPPASCDTKQTRQPYLPGGAVSPDTGRENQKRYEPGSFQYPQTPTSV
ASARFNGFLAQAHQISEPNGNTMVPHDSRHENNGNTKEFPVAQQMTNGGMTGYRPRTEDH
DRRETERFQINLHGFNMRGSSSPSNQVEAEWIEQYEPGVYLTLVSLRDGTKELKRVRFSR
RRFGEHQAESWWNDNREKVYDKYNVRGTDRISSVMTA
Download sequence
Identical sequences Q7XTM0
LOC_Os04g58960.1|13104.m06211|protein XP_015637135.1.37577 39947.LOC_Os04g58960.1 LOC_Os04g58960.1|PACid:21896322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]