SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015638845.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015638845.1.37577
Domain Number 1 Region: 215-601
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.79e-95
Family Regulator of chromosome condensation RCC1 0.00056
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-25
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 600-667
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.3e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015638845.1.37577
Sequence length 1033
Comment PREDICTED: E3 ubiquitin-protein ligase HERC2 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MTPDDNALITLKKGSKLIKYSRKGKPKIREFRLSSDENTLVWYSHNKEKCLRLSSVSKVI
PGQRTAVFRRFLRPEKDYLSFSLIYKNGQRSLDLVCKDQAEVEVWFSTLESLITSCRLNF
LNDGQTDRVSFSEDVTIYQDSTSYDTTLDIASSITRSFNSAGYSTPNSLNSIRADVGSDR
VNMLRASTGDNSRVSISSAPSSSSQSSGLDDIESLGDVYVWGEVWTEVLPSEGSSNYLCS
KTDFLIPKPLESDVVLDVQQIACGSRHIGLTTRQGEVFTWGEELGGRLGHGTDTDICRPK
LVESLAVSNVEYIACGEFHTCVVTASGDLYDWGDGSYNAGLLGHGTGVSHWLPKRVSGPL
EGLQVLSVACGSWHSALTMSSGKLFTFGDGTFGSLGHGDRESVAYPKEVEALSGFRAMKV
ACGVWHSAAIVEISGQASTNAMSRKLFTWGDGDKNRLGHGDKEAKLVPTCVQALVDHNFH
QVACGHSMTVALATSGHVFTMGSSNNGQLGNPKADGKQPCMVQDKLGNELVEEISCGSNH
VAALTSRSEVYTWGMGANGRLGHGSVEDKKKPTLVDALKDRHVKSISCGSNFTTCICIHK
WVSGADQSVCSGCRQPFGFTRKRHNCYNCGLVHCHACSSRKVLKAALAPTPGKPHRVCDS
CFMKLKAADTGVISSYNKRNVITRRSIDIKDKLERPEIRPSRLATTSPAEPVKYQETKNV
RNETKPADPMSMMKASQVPAMLQFKDMAFAGTFGTVPTTVKSMTMGGQMQMGMPMFSPSP
PSKKPSPPPATASPLIGKVDNDGLKKTNELLNQDISKLQSQVNKLKQKCETQDEQLQKAE
RKAKQAASMASEESARRNTVLDFVKHLDSELKVIADRVPGDVADNLKTLQSQSERFLAGQ
SSNLVEITGLTGHDIGHHRSSSTGSLPVSQDGSSGNASGSSIAMASDSPCHRIMENNLKA
PGDFAPKYGTHGEVQLIEQFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWREN
QERVFKKYNHPTN
Download sequence
Identical sequences LOC_Os05g46740.1|13105.m04998|protein LOC_Os05g46740.2|13105.m04997|protein 39947.LOC_Os05g46740.1 LOC_Os05g46740.1|PACid:21942789 LOC_Os05g46740.2|PACid:21942790 XP_015638845.1.37577 XP_015638846.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]