SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015641441.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015641441.1.37577
Domain Number 1 Region: 120-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-52
Family Glutathione peroxidase-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015641441.1.37577
Sequence length 265
Comment PREDICTED: putative peroxiredoxin Q, chloroplastic isoform X1 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MAFAVSTACRPSLLLPPRQRSSPPRPRPLLCTPSTAAFRRGALSATTTPTPARAALPSTT
GRNRIVCGKVTTTNNYPSSCRSRRSTMMHAAAWLLLQQLSPAAARVARAADDDSSVQVSK
GSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAE
VIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGV
VQYIYNNQFQPEKHIGETLKILQSL
Download sequence
Identical sequences A0A0E0PUN2
LOC_Os06g09610.1|13106.m01037|protein OsIBCD019707 LOC_Os06g09610.1|PACid:21928875 XP_015641441.1.37577 39946.BGIOSIBCE020978 39947.LOC_Os06g09610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]