SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015658388.1.39912 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015658388.1.39912
Domain Number 1 Region: 104-272
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-31
Family G proteins 0.0002
Further Details:      
 
Domain Number 2 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015658388.1.39912
Sequence length 308
Comment ADP-ribosylation factor-like protein [Leptomonas pyrrhocoris]; AA=GCF_001293395.1; RF=representative genome; TAX=157538; STAX=157538; NAME=Leptomonas pyrrhocoris; AL=Scaffold; RT=Major
Sequence
MTEEEARIGYAKEHNIHHLFELMATKLLVNRPENPFAYLRTLLEDVERGEKNKASYDPTR
VHFNDSRETSAVGLAGSSGAAEPQAADGAAAAAPSSSSSHKKKEKKNVTLATFGLDEAGK
TCALAVLETGEAEPHYSPTVGFAPVKFPLDEYNLCIFDLGGAANFRGIWVHYYHDAHGIV
YVMDSAASEERVAESLKVLQETLRHPYVQGKPLLVMANKKDLPGSRGVDVVPQGFIEEAM
GDTPAPYRVIATCAIEDDPALVEGIEWLLDCVAKDYEALTARVARDCKTVKEEKDRQRAE
RLAAIQGE
Download sequence
Identical sequences A0A0M9G0Y3
XP_015658388.1.39912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]