SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015662808.1.39912 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015662808.1.39912
Domain Number 1 Region: 437-482
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000000808
Family Transcriptional factor domain 0.0037
Further Details:      
 
Domain Number 2 Region: 173-254
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000497
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0039
Further Details:      
 
Domain Number 3 Region: 3-49
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000325
Family PWWP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015662808.1.39912
Sequence length 483
Comment transcription elongation factor-like protein [Leptomonas pyrrhocoris]; AA=GCF_001293395.1; RF=representative genome; TAX=157538; STAX=157538; NAME=Leptomonas pyrrhocoris; AL=Scaffold; RT=Major
Sequence
MASYAPGDRVWVYIEGDGWWPARVLSDEEIGARTPGQDIAVHFYAGIDTPASLYELNSHS
EAAHICFFETSSEKAVTSSAELEASIRHAAEDATANPLKSDSAISASAAVAAAAATTGAG
GAPGGASTIDPTAAVTRAAAKRMREMDDVDMAGSSGDGGAAAATMSDAGFRHLRTDDLHR
LSEKIAAAVEAHSLTKVRAALCQLDGVDVYLTELEETKIGIAVGSVLSQPSLKPLWPLAR
AIVSFWSRHLPAETLAAIRTVKQQDISATGKSGVEPGSPNEPSSPVGATQSPLRKAPAPG
SPGVAGGGSAFDHVGSPSAANEGTPLPPKSSSFLRHVRQRLDNPDNSVRYDDAVVEEVAR
RIAADITDFDDRQLLLVRLGEPDMEFLRMKLLSGEWTPRKYLEQPNEIFLTEKQKSEEAQ
RVANKMKAIEAAANAGVNLTHLFKCERCGKRDCTFYELQIRGADEPTTKYITCLNCKNSW
SQE
Download sequence
Identical sequences A0A0M9G835
XP_015662808.1.39912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]