SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015708474.1.68032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015708474.1.68032
Domain Number 1 Region: 45-192
Classification Level Classification E-value
Superfamily EF-hand 2.38e-35
Family Calmodulin-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015708474.1.68032
Sequence length 194
Comment PREDICTED: myosin light chain 3 [Coturnix japonica]; AA=GCF_001577835.1; RF=representative genome; TAX=93934; STAX=93934; NAME=Coturnix japonica; AL=Chromosome; RT=Major
Sequence
MPPKKPEPKKAPEPKKEEPKPAPKPAEPEPKKEVEFNPASIKVEFTPDQIEEFKEAFSLF
DRTPKSEMKITYAQCGDVLRALGQNPTQAEVMKVLGRPKQEDMNSKMIDFETFLPMLQHI
AKTKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEEEVDKLMAGQEDANG
CINYEAFVKHIMAN
Download sequence
Identical sequences G1MUW1
ENSMGAP00000002363 ENSMGAP00000002363 XP_003206959.1.16129 XP_015708474.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]