SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015730333.1.68032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015730333.1.68032
Domain Number 1 Region: 40-539
Classification Level Classification E-value
Superfamily Sema domain 2.35e-101
Family Sema domain 0.00071
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.02e-38
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 973-1063
Classification Level Classification E-value
Superfamily E set domains 0.000000000000255
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Domain Number 4 Region: 883-962
Classification Level Classification E-value
Superfamily E set domains 0.00000000000165
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 5 Region: 542-594
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000102
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1062-1146
Classification Level Classification E-value
Superfamily E set domains 0.000000000726
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015730333.1.68032
Sequence length 1925
Comment PREDICTED: plexin-D1 [Coturnix japonica]; AA=GCF_001577835.1; RF=representative genome; TAX=93934; STAX=93934; NAME=Coturnix japonica; AL=Chromosome; RT=Major
Sequence
MGAGTGMDPAASAEPRPLALLPLLLLPLLLPGGAAGLEVQRKFVSPTPTNNFALDGPGSR
VYLAAVNRLFQLSGGELALQAEAAVGPVLDSPLCHAPQLPQASCEHPKVLTNNYNKILQP
DPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPGGSDPLAVFPSMLNVAANHPNASTV
GLLLRRGSGGGGGARLLVAATYTGFGSPFFPRNSSLEDHRFENTPEIAIRALNARGDLAK
LFTFDINPSDDNIFKIKQGAKARHKLSFVRAFLQRSRRPYAYLALNSEANAVDKESPSHS
LLARICLGDAAEATLNGSGEPKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAWGAPAE
EELLFGVFERVGAGGGRPHSALCVFRFAEIEETIRAARNSCFVSPAAGMVAVLDSVVQGT
GPACEKRNIQLQPEQLDCGAAHLQHPLAIVNPITATPIFTYNGLTAVAVASVNNYTVVFL
GTASGGLLKINLDSAMRVVSRRSISVAYGEPVHPIMQFDPSDPTYLYLMTSYQMTRVKVA
ACEQYSTCAECLAAADAYCGWCTMETRCSLQHECMNFTEANFWASASEGVQQCPSMTILE
PEINTDKENPVLIIQINGTIPNLNGTNISCDYGNNIRTVARVAGDYANQFIYCSLLPRQK
YPAFPKDQDHVTVKTALRVNGKNIIQANFTIYDCKRTGNIYPKRACTRCLSTKWKCYWCP
SRYMCVSNHSWCEDALQMRNKIDCPQIVPAPLDPMPTGMSRDITITLANAIFSEETTLEC
HFGMERTFEARWVNSSAVECVHVLLHTSEKSHLFPINLQLKDRPDRFIDSPEMMTVEVYN
CATGSADCSQCLGREDLGHRCVWSESSSSCRLSTESPLPSDVCPAPEIKKIEPLRGPLEG
GTLLTIQGRNLGRRFSDIQGAIRIGSVPCVPLPDRYIVSETIVCQTGMAQEVFADVVTVN
VSREGKSRERYSYVLPMVQSIAPQNGPKAGGTRVTIRGSWLDVGSELRVLVNSSKQCTDL
SRNDSTITCSMPSAELTTAVRICVQFESRSCASHSITFKYEKNPIVTDINPKKSQISGGR
IITVEGRGFELIQNASMVVRGIGREQTSCKVHTDTVITCPSPAASNITAGSKPASVDFYL
NGRLYTDDHPVLDEEMYPEEALHISKFSLEYYADPQFFTAKKEKWIKHHPGEPLTLVIHK
EPDNLGLESSEYQVKIGLISCEIQIVSDKVIHCSVNESLSTSERQLPVTIQVGKFNYTIA
MLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREE
IRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYILPSQQLSSQ
VGSQVQETHPLLVGEWKIPESCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDFAVRD
RCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSI
CMYSYLRETVGEPLFMLYCAIKQQMEKGPIDAITGEARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNIPYSQWPRVEDVDLEWFATSTDSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDGTLNRVKDLDTEKYFHLVLPT
DESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIQDDKPPVAVKYF
FDFLEEQAEKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEE
SRKYRNEFNTNVAMAEIYKYAKRYRSQIMAALDSNPTTKRTQLQHKFEQVIALMEDNIYE
CCSEA
Download sequence
Identical sequences XP_015730333.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]